Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPL23A AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that RPL23A is expressed in ACHN)

Rabbit RPL23A Polyclonal Antibody | anti-RPL23A antibody

RPL23A antibody - N-terminal region

Gene Names
RPP40; RNASEP1; bA428J1.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPL23A; Polyclonal Antibody; RPL23A antibody - N-terminal region; anti-RPL23A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLT
Sequence Length
156
Applicable Applications for anti-RPL23A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPL23A AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that RPL23A is expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-RPL23A AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that RPL23A is expressed in ACHN)
Related Product Information for anti-RPL23A antibody
This is a rabbit polyclonal antibody against RPL23A. It was validated on Western Blot

Target Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins. It is located in the cytoplasm. The protein may be one of the target molecules involved in mediating growth inhibition by interferon. In yeast, the corresponding protein binds to a specific site on the 26S rRNA. This gene is co-transcribed with the U42A, U42B, U101A, and U101B small nucleolar RNA genes, which are located in its third, first, second, and fourth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
ribonuclease P protein subunit p40 isoform a
NCBI Official Synonym Full Names
ribonuclease P/MRP subunit p40
NCBI Official Symbol
RPP40
NCBI Official Synonym Symbols
RNASEP1; bA428J1.3
NCBI Protein Information
ribonuclease P protein subunit p40
UniProt Protein Name
Ribonuclease P protein subunit p40
Protein Family
UniProt Gene Name
RPP40
UniProt Synonym Gene Names
RNASEP1; RNaseP protein p40
UniProt Entry Name
RPP40_HUMAN

Uniprot Description

Function: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

Catalytic activity: Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

Subunit structure: RNase P consists of a RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

Subcellular location: Nucleus › nucleolus

Potential.

Sequence caution: The sequence AAC24114.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH17871.1 differs from that shown. Reason: Frameshift at position 327. The sequence CAH73740.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on RPL23A

Similar Products

Product Notes

The RPL23A rpp40 (Catalog #AAA3215417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPL23A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPL23A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPL23A rpp40 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HSHKKKKIRT SPTFRRPKTL RLRRQPKYPR KSAPRRNKLD HYAIIKFPLT. It is sometimes possible for the material contained within the vial of "RPL23A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.