Mouse anti-Human RPL23A Monoclonal Antibody | anti-RPL23A antibody

RPL23A (60S Ribosomal Protein L23a, FLJ27455, MDA20) (FITC)

Cat. Num. AAA6149427

• Gene Names: RPL23A; L23A; MDA20
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RPL23A; Monoclonal Antibody; RPL23A (60S Ribosomal Protein L23a; FLJ27455; MDA20) (FITC); anti-RPL23A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E11
• Specificity: Recognizes human RPL23A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RPL23A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa59-157 from human RPL23A (NP_000975) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RPL23A expression in transfected 293T cell line by RPL23A monoclonal antibody. Lane 1: RPL23A transfected lysate (17.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RPL23A antibody

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL23A is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins. It is located in the cytoplasm. The protein may be one of the target molecules involved in mediating growth inhibition by interferon. In yeast, the corresponding protein binds to a specific site on the 26S rRNA. This gene is co-transcribed with the U42A, U42B, U101A, and U101B small nucleolar RNA genes, which are located in its third, first, second, and fourth introns, respectively.

Product Categories/Family for anti-RPL23A antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 17105394
• NCBI GeneID: 6147
• NCBI Accession #: NP_000975
• NCBI GenBank Nucleotide #: NM_000984
• UniProt Accession #: P62750; P29316; P39024; Q92774; B2R5B2
• Molecular Weight: 20.1kDa (179aa) confirmed by MALDI-TOF
• NCBI Official Full Name: 60S ribosomal protein L23a
• NCBI Official Synonym Full Names: ribosomal protein L23a
• NCBI Official Symbol: RPL23A
• NCBI Official Synonym Symbols: L23A; MDA20
• NCBI Protein Information: 60S ribosomal protein L23a
• UniProt Protein Name: 60S ribosomal protein L23a
• Protein Family: 60S ribosomal protein
• UniProt Gene Name: RPL23A
• UniProt Entry Name: RL23A_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins. It is located in the cytoplasm. The protein may be one of the target molecules involved in mediating growth inhibition by interferon. In yeast, the corresponding protein binds to a specific site on the 26S rRNA. This gene is co-transcribed with the U42A, U42B, U101A, and U101B small nucleolar RNA genes, which are located in its third, first, second, and fourth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPL23A: This protein binds to a specific region on the 26S rRNA. Belongs to the ribosomal protein L23P family.

Protein type: Ribosomal; Translation

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cytoplasm; nucleolus; TORC2 complex; nucleus; cytosol

Molecular Function: rRNA binding; protein binding; structural constituent of ribosome; nucleotide binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; cell proliferation; cellular protein metabolic process; translational elongation; viral reproduction; translation; translational initiation; mRNA catabolic process, nonsense-mediated decay; viral transcription; gene expression; viral infectious cycle; translational termination