Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPH3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Rabbit RPH3A Polyclonal Antibody | anti-RPH3A antibody

RPH3A antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPH3A; Polyclonal Antibody; RPH3A antibody - N-terminal region; anti-RPH3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRK
Sequence Length
690
Applicable Applications for anti-RPH3A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RPH3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPH3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-RPH3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Related Product Information for anti-RPH3A antibody
This is a rabbit polyclonal antibody against RPH3A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Product Categories/Family for anti-RPH3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
rabphilin-3A isoform 2
NCBI Official Synonym Full Names
rabphilin 3A
NCBI Official Symbol
RPH3A
NCBI Protein Information
rabphilin-3A
UniProt Protein Name
Rabphilin-3A
Protein Family
UniProt Gene Name
RPH3A
UniProt Synonym Gene Names
KIAA0985
UniProt Entry Name
RP3A_HUMAN

NCBI Description

The protein encoded by this gene is thought to be an effector for RAB3A, which is a small G protein that acts in the late stages of neurotransmitter exocytosis. The encoded protein may be involved in neurotransmitter release and synaptic vesicle traffic. [provided by RefSeq, Dec 2016]

Uniprot Description

rabphilin 3A: Protein transport. Probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: Golgi apparatus; synaptic vesicle; neuron projection; protein complex; extrinsic to membrane; synaptic vesicle membrane; synapse; cytosol; cell junction; secretory granule

Molecular Function: phosphatidylinositol-4,5-bisphosphate binding; selenium binding; protein binding; zinc ion binding; calcium-dependent phospholipid binding; transporter activity; protein complex binding; calcium ion binding; phosphate binding; Rab GTPase binding

Biological Process: intracellular protein transport

Research Articles on RPH3A

Similar Products

Product Notes

The RPH3A rph3a (Catalog #AAA3224519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPH3A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPH3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPH3A rph3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQPDRQRKQE ELTDEEKEII NRVIARAEKM EEMEQERIGR LVDRLENMRK. It is sometimes possible for the material contained within the vial of "RPH3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.