Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ROPN1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit ROPN1L Polyclonal Antibody | anti-ROPN1L antibody

ROPN1L antibody - N-terminal region

Gene Names
ROPN1L; ASP; RSPH11
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ROPN1L; Polyclonal Antibody; ROPN1L antibody - N-terminal region; anti-ROPN1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVE
Sequence Length
230
Applicable Applications for anti-ROPN1L antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ROPN1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ROPN1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ROPN1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ROPN1L antibody
This is a rabbit polyclonal antibody against ROPN1L. It was validated on Western Blot

Target Description: This gene encodes a member of the ropporin family. The encoded protein is a sperm protein. It interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them.
Product Categories/Family for anti-ROPN1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
ropporin-1-like protein
NCBI Official Synonym Full Names
rhophilin associated tail protein 1 like
NCBI Official Symbol
ROPN1L
NCBI Official Synonym Symbols
ASP; RSPH11
NCBI Protein Information
ropporin-1-like protein
UniProt Protein Name
Ropporin-1-like protein
Protein Family
UniProt Gene Name
ROPN1L
UniProt Synonym Gene Names
ASP; ROPN1-like protein
UniProt Entry Name
ROP1L_HUMAN

NCBI Description

This gene encodes a member of the ropporin family. The encoded protein is present in sperm and interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2014]

Research Articles on ROPN1L

Similar Products

Product Notes

The ROPN1L ropn1l (Catalog #AAA3214853) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ROPN1L antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ROPN1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ROPN1L ropn1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYFSALSRGD PLPVKDRMEM PTATQKTDTG LTQGLLKVLH KQCHHKRYVE. It is sometimes possible for the material contained within the vial of "ROPN1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.