Immunohistochemistry (IHC)
(Human Skin )
Rabbit RNF25 Polyclonal Antibody | anti-RNF25 antibody
RNF25 antibody - middle region
Gene Names
RNF25; AO7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RNF25; Polyclonal Antibody; RNF25 antibody - middle region; anti-RNF25 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG
Sequence Length
459
Applicable Applications for anti-RNF25 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNF25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Skin )
Immunohistochemistry (IHC)
(Human Skin )
Western Blot (WB)
(WB Suggested Anti-RNF25 Antibody Titration: 0.5 ug/mlPositive Control: HepG2 cell lysateRNF25 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-RNF25 Antibody Titration: 0.5 ug/mlPositive Control: HepG2 cell lysateRNF25 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-RNF25 antibody
This is a rabbit polyclonal antibody against RNF25. It was validated on Western Blot and immunohistochemistry
Target Description: RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.
Target Description: RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.
Product Categories/Family for anti-RNF25 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF25
NCBI Official Synonym Full Names
ring finger protein 25
NCBI Official Symbol
RNF25
NCBI Official Synonym Symbols
AO7
NCBI Protein Information
E3 ubiquitin-protein ligase RNF25
UniProt Protein Name
E3 ubiquitin-protein ligase RNF25
Protein Family
UniProt Gene Name
RNF25
UniProt Entry Name
RNF25_HUMAN
NCBI Description
The protein encoded by this gene contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination. [provided by RefSeq, Jul 2008]
Research Articles on RNF25
Similar Products
Product Notes
The RNF25 rnf25 (Catalog #AAA3206803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF25 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNF25 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RNF25 rnf25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CREPLVYDLA SLKAAPEPQQ PMELYQPSAE SLRQQEERKR LYQRQQERGG. It is sometimes possible for the material contained within the vial of "RNF25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
