Western Blot (WB)
(Host: RabbitTarget Name: RNF19BSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Rabbit RNF19B Polyclonal Antibody | anti-RNF19B antibody
RNF19B Antibody - C-terminal region
Gene Names
RNF19B; NKLAM; IBRDC3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF19B; Polyclonal Antibody; RNF19B Antibody - C-terminal region; anti-RNF19B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIGVPIMLA
Sequence Length
486
Applicable Applications for anti-RNF19B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF19B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RNF19BSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RNF19BSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-RNF19B antibody
This is a rabbit polyclonal antibody against RNF19B. It was validated on Western Blot
Target Description: IBRDC3 is a cytolysis-associated transmembrane protein expressed in natural killer (NK) cells and T lymphocytes following cytokine stimulation.
Target Description: IBRDC3 is a cytolysis-associated transmembrane protein expressed in natural killer (NK) cells and T lymphocytes following cytokine stimulation.
Product Categories/Family for anti-RNF19B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF19B isoform b
NCBI Official Synonym Full Names
ring finger protein 19B
NCBI Official Symbol
RNF19B
NCBI Official Synonym Symbols
NKLAM; IBRDC3
NCBI Protein Information
E3 ubiquitin-protein ligase RNF19B
UniProt Protein Name
E3 ubiquitin-protein ligase RNF19B
Protein Family
UniProt Gene Name
RNF19B
UniProt Synonym Gene Names
IBRDC3; NKLAM
UniProt Entry Name
RN19B_HUMAN
NCBI Description
This gene encodes a multi-pass membrane protein containing two RING-type and one IBR-type zinc finger motifs. The encoded protin is an E3 ubiquitin-protein ligase that plays a role in the cytotoxic effects of natural killer (NK) cells. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes X and Y in a possible pseudoautosomal region. [provided by RefSeq, Jul 2014]
Research Articles on RNF19B
Similar Products
Product Notes
The RNF19B rnf19b (Catalog #AAA3218919) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF19B Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RNF19B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF19B rnf19b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRKIHSRYEG RKTSKHKRNL AITGGVTLSV IASPVIAAVS VGIGVPIMLA. It is sometimes possible for the material contained within the vial of "RNF19B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
