Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RNF139 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateRNF139 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit RNF139 Polyclonal Antibody | anti-RNF139 antibody

RNF139 antibody - N-terminal region

Gene Names
RNF139; RCA1; TRC8; HRCA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF139; Polyclonal Antibody; RNF139 antibody - N-terminal region; anti-RNF139 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR
Sequence Length
664
Applicable Applications for anti-RNF139 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 87%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RNF139
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RNF139 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateRNF139 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-RNF139 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateRNF139 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-RNF139 antibody
This is a rabbit polyclonal antibody against RNF139. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RNF139 is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP. The protein encoded by this gene is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP.
Product Categories/Family for anti-RNF139 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF139
NCBI Official Synonym Full Names
ring finger protein 139
NCBI Official Symbol
RNF139
NCBI Official Synonym Symbols
RCA1; TRC8; HRCA1
NCBI Protein Information
E3 ubiquitin-protein ligase RNF139
UniProt Protein Name
E3 ubiquitin-protein ligase RNF139
UniProt Gene Name
RNF139
UniProt Entry Name
RN139_HUMAN

NCBI Description

The protein encoded by this gene is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP. [provided by RefSeq, Jul 2008]

Uniprot Description

RNF139: E3-ubiquitin ligase; acts as a negative regulator of the cell proliferation through mechanisms involving G2/M arrest and cell death. Required for MHC class I ubiquitination in cells expressing the cytomegalovirus protein US2 before dislocation from the endoplasmic reticulum (ER). Affects SREBP processing by hindering the SREBP/SCAP complex translocation from the ER to the Golgi, thereby reducing SREBF2 target gene expression. Required for INSIG1 ubiquitination. May be required for EIF3 complex ubiquitination. May function as a signaling receptor. Defects in RNF139 may be a cause of renal cell carcinoma (RCC). It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. A chromosomal aberration involving RNF139 has been found in a lymphoblastoid cell line established from a family with renal cell carcinoma and thyroid carcinoma. Translocation (3;8)(q14.2;q24.1) with FHIT. RNF139 is found to be fused to FHIT and disrupted within the sterol-sensing domain. In contrast, the FHIT coding region is maintained and expressed. Sporadic cases of renal carcinoma, where an acquired mutation in RNF139 results in the duplication of 12 nucleotides in the 5'-UTR, has also been identified.

Protein type: Ligase; Membrane protein, multi-pass; EC 6.3.2.-; EC 6.3.2.19; Membrane protein, integral; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 8q24

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; protease binding; small conjugating protein ligase activity; zinc ion binding; ubiquitin-protein ligase activity; receptor activity; ligase activity

Biological Process: negative regulation of cell proliferation; protein destabilization; regulation of protein ubiquitination; negative regulation of translation; protein ubiquitination

Disease: Renal Cell Carcinoma, Nonpapillary

Research Articles on RNF139

Similar Products

Product Notes

The RNF139 rnf139 (Catalog #AAA3206706) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF139 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNF139 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF139 rnf139 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQRSLFKFYT YSSAFLLAAT SVLVNYYASL HIDFYGAYNT SAFGIELLPR. It is sometimes possible for the material contained within the vial of "RNF139, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.