Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RNASET2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in in alveolar cells, type I and IIPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit RNASET2 Polyclonal Antibody | anti-RNASET2 antibody

RNASET2 antibody - middle region

Gene Names
RNASET2; RNASE6PL; bA514O12.3
Reactivity
Dog, Horse, Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RNASET2; Polyclonal Antibody; RNASET2 antibody - middle region; anti-RNASET2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
Sequence Length
256
Applicable Applications for anti-RNASET2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 79%; Horse: 79%; Human: 100%; Rat: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNASET2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RNASET2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in in alveolar cells, type I and IIPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-RNASET2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in in alveolar cells, type I and IIPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-RNASET2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateRNASET2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-RNASET2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateRNASET2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-RNASET2 antibody
This is a rabbit polyclonal antibody against RNASET2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
Product Categories/Family for anti-RNASET2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
ribonuclease T2
NCBI Official Synonym Full Names
ribonuclease T2
NCBI Official Symbol
RNASET2
NCBI Official Synonym Symbols
RNASE6PL; bA514O12.3
NCBI Protein Information
ribonuclease T2
UniProt Protein Name
Ribonuclease T2
Protein Family
UniProt Gene Name
RNASET2
UniProt Synonym Gene Names
RNASE6PL
UniProt Entry Name
RNT2_HUMAN

NCBI Description

This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. [provided by RefSeq, Jul 2008]

Uniprot Description

RNASET2: Has ribonuclease activity, with higher activity at acidic pH. May play a role in cellular RNA catabolism. Defects in RNASET2 are the cause of leukoencephalopathy cystic without megalencephaly (LCWM). An infantile- onset syndrome of cerebral leukoencephalopathy. Affected newborns develop microcephaly and neurologic abnormalities including psychomotor impairment, seizures and sensorineural hearing impairment. The brain shows multifocal white matter lesions, anterior temporal lobe subcortical cysts, pericystic abnormal myelination, ventriculomegaly and intracranial calcifications. Belongs to the RNase T2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; EC 3.1.27.-; Secreted; RNA-binding; Ribonuclease

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: lysosomal lumen; extracellular space; endoplasmic reticulum lumen; lysosome; extracellular region

Molecular Function: ribonuclease T2 activity; RNA binding; ribonuclease activity

Biological Process: RNA catabolic process

Disease: Leukoencephalopathy, Cystic, Without Megalencephaly

Research Articles on RNASET2

Similar Products

Product Notes

The RNASET2 rnaset2 (Catalog #AAA3201344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASET2 antibody - middle region reacts with Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNASET2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RNASET2 rnaset2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSRFWKHEWE KHGTCAAQVD ALNSQKKYFG RSLELYRELD LNSVLLKLGI. It is sometimes possible for the material contained within the vial of "RNASET2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.