Western Blot (WB)
(WB Suggested Anti-RNASE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Rabbit RNASE1 Polyclonal Antibody | anti-RNASE1 antibody
RNASE1 antibody - N-terminal region
Gene Names
RNASE1; RAC1; RIB1; RNS1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNASE1; Polyclonal Antibody; RNASE1 antibody - N-terminal region; anti-RNASE1 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS
Sequence Length
156
Applicable Applications for anti-RNASE1 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RNASE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RNASE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Western Blot (WB)
(WB Suggested Anti-RNASE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Related Product Information for anti-RNASE1 antibody
This is a rabbit polyclonal antibody against RNASE1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substr
Target Description: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substr
Product Categories/Family for anti-RNASE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
ribonuclease pancreatic
NCBI Official Synonym Full Names
ribonuclease A family member 1, pancreatic
NCBI Official Symbol
RNASE1
NCBI Official Synonym Symbols
RAC1; RIB1; RNS1
NCBI Protein Information
ribonuclease pancreatic
UniProt Protein Name
Ribonuclease pancreatic
Protein Family
UniProt Gene Name
RNASE1
UniProt Synonym Gene Names
RIB1; RNS1; RNase 1; RNase A
NCBI Description
This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA.
Research Articles on RNASE1
1. Data suggest that ribonuclease inhibitor (RNH1) protects HeLa cells from ribonuclease 1 (RNase 1).
Similar Products
Product Notes
The RNASE1 rnase1 (Catalog #AAA3205224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASE1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNASE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNASE1 rnase1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MALEKSLVRL LLLVLILLVL GWVQPSLGKE SRAKKFQRQH MDSDSSPSSS. It is sometimes possible for the material contained within the vial of "RNASE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
