Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RLBP1Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit RLBP1 Polyclonal Antibody | anti-RLBP1 antibody

RLBP1 Antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
RLBP1; Polyclonal Antibody; RLBP1 Antibody - N-terminal region; anti-RLBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFI
Sequence Length
317
Applicable Applications for anti-RLBP1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Pig: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RLBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RLBP1Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RLBP1Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RLBP1 antibody
retinaldehyde binding protein 1

Target Description: The protein encoded by this gene is a 36-kD water-soluble protein which carries 11-cis-retinaldehyde or 11-cis-retinal as physiologic ligands. It may be a functional component of the visual cycle. Mutations of this gene have been associated with severe rod-cone dystrophy, Bothnia dystrophy (nonsyndromic autosomal recessive retinitis pigmentosa) and retinitis punctata albescens.
Product Categories/Family for anti-RLBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
retinaldehyde-binding protein 1
UniProt Protein Name
Retinaldehyde-binding protein 1
UniProt Gene Name
RLBP1
UniProt Synonym Gene Names
CRALBP

Uniprot Description

RLBP1: Soluble retinoid carrier essential the proper function of both rod and cone photoreceptors. Participates in the regeneration of active 11-cis-retinol and 11-cis-retinaldehyde, from the inactive 11-trans products of the rhodopsin photocycle and in the de novo synthesis of these retinoids from 11-trans metabolic precursors. The cycling of retinoids between photoreceptor and adjacent pigment epithelium cells is known as the 'visual cycle'. Defects in RLBP1 are a cause of retinitis pigmentosa autosomal recessive (ARRP). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Defects in RLBP1 are the cause of Bothnia retinal dystrophy (BRD); also known as Vasterbotten dystrophy. Affected individuals show night blindness from early childhood with features consistent with retinitis punctata albescens and macular degeneration. Defects in RLBP1 are the cause of rod-cone dystrophy Newfoundland (NFRCD). NFRCD is a retinal dystrophy reminiscent of retinitis punctata albescens but with a substantially lower age at onset and more-rapid and distinctive progression. Rod-cone dystrophies results from initial loss of rod photoreceptors, later followed by cone photoreceptors loss. Defects in RLBP1 are a cause of retinitis punctata albescens (RPA). A rare form of stationary night blindness characterized by a delay in the regeneration of cone and rod photopigments.

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: cytosol

Biological Process: retinoid metabolic process; vitamin A metabolic process

Disease: Bothnia Retinal Dystrophy; Fundus Albipunctatus; Newfoundland Rod-cone Dystrophy

Similar Products

Product Notes

The RLBP1 rlbp1 (Catalog #AAA3214503) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RLBP1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RLBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RLBP1 rlbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELNEREETRE EAVRELQEMV QAQAASGEEL AVAVAERVQE KDSGFFLRFI. It is sometimes possible for the material contained within the vial of "RLBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.