Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RIT1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit RIT1 Polyclonal Antibody | anti-RIT1 antibody

RIT1 antibody - C-terminal region

Gene Names
RIT1; NS8; RIT; RIBB; ROC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RIT1; Polyclonal Antibody; RIT1 antibody - C-terminal region; anti-RIT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKD
Sequence Length
219
Applicable Applications for anti-RIT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 86%; Sheep: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RIT1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Western Blot (WB) (WB Suggested Anti-RIT1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-RIT1 antibody
This is a rabbit polyclonal antibody against RIT1. It was validated on Western Blot

Target Description: RIT belongs to the RAS subfamily of small GTPases.
Product Categories/Family for anti-RIT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
GTP-binding protein Rit1 isoform 2
NCBI Official Synonym Full Names
Ras like without CAAX 1
NCBI Official Symbol
RIT1
NCBI Official Synonym Symbols
NS8; RIT; RIBB; ROC1
NCBI Protein Information
GTP-binding protein Rit1
UniProt Protein Name
GTP-binding protein Rit1
Protein Family
UniProt Gene Name
RIT1
UniProt Synonym Gene Names
RIBB; RIT; ROC1
UniProt Entry Name
RIT1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]

Uniprot Description

RIT1: a small G protein of the Ras family. Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and p38-alpha signaling pathways and in NGF- dependent neuronal differentiation. Stimulation of the NGF and EGF receptor signaling pathways results in rapid and prolonged activation. Interacts with afadin, the C-terminal domain of RalGDS and RLF, but not with RIN1 and PIK3CA. RLF binds exclusively to the active GTP-bound form. Strongly interacts with BRAF, but only weakly with c-Raf. BRAF and c-RAF association is dependent upon the GTP-bound state. Interacts with RGL3. Shows rapid uncatalyzed guanine nucleotide dissociation rates, which are much faster than those of most Ras subfamily members.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Ras

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: plasma membrane

Molecular Function: calmodulin binding; protein binding; GTP binding

Biological Process: nerve growth factor receptor signaling pathway; small GTPase mediated signal transduction; Ras protein signal transduction; signal transduction

Disease: Noonan Syndrome 8

Research Articles on RIT1

Similar Products

Product Notes

The RIT1 rit1 (Catalog #AAA3215340) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIT1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's RIT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIT1 rit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRYYIDDVFH ALVREIRRKE KEAVLAMEKK SKPKNSVWKR LKSPFRKKKD. It is sometimes possible for the material contained within the vial of "RIT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.