Western Blot (WB)
(Host: RabbitTarget Name: RHOASample Type: Rat HeartAntibody Dilution: 1.0ug/ml)
Rabbit anti-Rat RHOA Polyclonal Antibody | anti-RHOA antibody
RHOA Antibody - C-terminal
Gene Names
Rhoa; Arha; Arha2
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
RHOA; Polyclonal Antibody; RHOA Antibody - C-terminal; anti-RHOA antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Sequence Length
193
Applicable Applications for anti-RHOA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RHOA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RHOASample Type: Rat HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHOASample Type: Rat HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RHOA antibody
This is a rabbit polyclonal antibody against RHOA. It was validated on Western Blot
Target Description: RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It is involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. It plays an essential role in cleavage furrow formation. It is required for the apical junction formation of keratinocyte cell-cell adhesion. It may be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. It is essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity). Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis.
Target Description: RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It is involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. It plays an essential role in cleavage furrow formation. It is required for the apical junction formation of keratinocyte cell-cell adhesion. It may be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. It is essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity). Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis.
Product Categories/Family for anti-RHOA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
transforming protein RhoA isoform X1
NCBI Official Synonym Full Names
ras homolog family member A
NCBI Official Symbol
Rhoa
NCBI Official Synonym Symbols
Arha; Arha2
NCBI Protein Information
transforming protein RhoA
UniProt Protein Name
Transforming protein RhoA
Protein Family
UniProt Gene Name
Rhoa
UniProt Synonym Gene Names
Arha; Arha2
UniProt Entry Name
RHOA_RAT
Research Articles on RHOA
Similar Products
Product Notes
The RHOA rhoa (Catalog #AAA3219136) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOA Antibody - C-terminal reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RHOA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOA rhoa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKMKQEPVKP EEGRDMANRI GAFGYMECSA KTKDGVREVF EMATRAALQA. It is sometimes possible for the material contained within the vial of "RHOA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
