Rabbit anti-Human RGS3 Polyclonal Antibody | anti-RGS3 antibody

RGS3 (Regulator of G-Protein Signaling 3, Regulator of G-Protein Signalling 3, RGS-3, C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ RGS3, PDZ-RGS3, RGP3) (PE)

Cat. Num. AAA6392473

• Gene Names: RGS3; C2PA; RGP3
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RGS3; Polyclonal Antibody; RGS3 (Regulator of G-Protein Signaling 3; Regulator of G-Protein Signalling 3; RGS-3; C2PA; FLJ20370; FLJ31516; FLJ90496; PDZ RGS3; PDZ-RGS3; RGP3) (PE); anti-RGS3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RGS3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 168

• Applicable Applications for anti-RGS3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RGS3, aa1-168 (NP_602299.1).
• Immunogen Sequence: MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RGS3 expression in transfected 293T cell line by RGS3 polyclonal antibody. Lane 1: RGS3 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RGS3 antibody

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. [provided by RefSeq]

Product Categories/Family for anti-RGS3 antibody

Antibodies; G Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 19913392
• NCBI GeneID: 5998
• NCBI Accession #: NP_602299.1
• NCBI GenBank Nucleotide #: NM_134427
• UniProt Accession #: P49796
• NCBI Official Full Name: regulator of G-protein signaling 3 isoform 4
• NCBI Official Synonym Full Names: regulator of G protein signaling 3
• NCBI Official Symbol: RGS3
• NCBI Official Synonym Symbols: C2PA; RGP3
• NCBI Protein Information: regulator of G-protein signaling 3
• UniProt Protein Name: Regulator of G-protein signaling 3
• Protein Family: Regulator of G-protein signaling
• UniProt Gene Name: RGS3
• UniProt Synonym Gene Names: RGP3; RGS3
• UniProt Entry Name: RGS3_HUMAN

NCBI Description

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013]

Uniprot Description

RGS3: Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G- protein-mediated release of inositol phosphates and activation of MAP kinases. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, RGS; GAPs

Chromosomal Location of Human Ortholog: 9q32

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; cytosol

Molecular Function: GTPase activator activity

Biological Process: regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity; inactivation of MAPK activity