Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RGS3 expression in transfected 293T cell line by RGS3 polyclonal antibody. Lane 1: RGS3 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RGS3 Polyclonal Antibody | anti-RGS3 antibody

RGS3 (Regulator of G-Protein Signaling 3, Regulator of G-Protein Signalling 3, RGS-3, C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ RGS3, PDZ-RGS3, RGP3) (Biotin)

Gene Names
RGS3; C2PA; RGP3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RGS3; Polyclonal Antibody; RGS3 (Regulator of G-Protein Signaling 3; Regulator of G-Protein Signalling 3; RGS-3; C2PA; FLJ20370; FLJ31516; FLJ90496; PDZ RGS3; PDZ-RGS3; RGP3) (Biotin); anti-RGS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RGS3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
168
Applicable Applications for anti-RGS3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RGS3, aa1-168 (NP_602299.1).
Immunogen Sequence
MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RGS3 expression in transfected 293T cell line by RGS3 polyclonal antibody. Lane 1: RGS3 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RGS3 expression in transfected 293T cell line by RGS3 polyclonal antibody. Lane 1: RGS3 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RGS3 antibody
This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. [provided by RefSeq]
Product Categories/Family for anti-RGS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
regulator of G-protein signaling 3 isoform 4
NCBI Official Synonym Full Names
regulator of G protein signaling 3
NCBI Official Symbol
RGS3
NCBI Official Synonym Symbols
C2PA; RGP3
NCBI Protein Information
regulator of G-protein signaling 3
UniProt Protein Name
Regulator of G-protein signaling 3
UniProt Gene Name
RGS3
UniProt Synonym Gene Names
RGP3; RGS3
UniProt Entry Name
RGS3_HUMAN

NCBI Description

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013]

Uniprot Description

RGS3: Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G- protein-mediated release of inositol phosphates and activation of MAP kinases. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, RGS; GAPs

Chromosomal Location of Human Ortholog: 9q32

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; cytosol

Molecular Function: GTPase activator activity

Biological Process: regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity; inactivation of MAPK activity

Research Articles on RGS3

Similar Products

Product Notes

The RGS3 rgs3 (Catalog #AAA6392465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS3 (Regulator of G-Protein Signaling 3, Regulator of G-Protein Signalling 3, RGS-3, C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ RGS3, PDZ-RGS3, RGP3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RGS3 rgs3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RGS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.