Rabbit anti-Human, Mouse RGS20 Polyclonal Antibody | anti-RGS20 antibody

RGS20 (Regulator of G-protein Signaling 20, Gz-selective GTPase-activating Protein, G(z)GAP, Gz-GAP, Regulator of G-protein Signaling Z1, Regulator of Gz-selective Protein Signaling 1, RGSZ1, ZGAP1) (Biotin)

Cat. Num. AAA6392454

• Gene Names: RGS20; RGSZ1; ZGAP1; gz-GAP; g(z)GAP
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RGS20; Polyclonal Antibody; RGS20 (Regulator of G-protein Signaling 20; Gz-selective GTPase-activating Protein; G(z)GAP; Gz-GAP; Regulator of G-protein Signaling Z1; Regulator of Gz-selective Protein Signaling 1; RGSZ1; ZGAP1) (Biotin); anti-RGS20 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RGS20. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 241

• Applicable Applications for anti-RGS20 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RGS20, aa1-241 (NP_003693.2).
• Immunogen Sequence: MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RGS20 rabbit polyclonal antibody. Western Blot analysis of RGS20 expression in mouse spleen.)

Western Blot (WB)

(Western Blot analysis of RGS20 expression in transfected 293T cell line by RGS20 polyclonal antibody. Lane 1: RGS20 transfected lysate (27.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RGS20 antibody

RGS proteins are regulatory and structural components GPCR complexes. These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways. RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP. It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain. RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure. It specifically interacts and accelerates the hydrolysis of G-alphaz. Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling. It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe.

Product Categories/Family for anti-RGS20 antibody

Antibodies; G Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13654235
• NCBI GeneID: 8601
• NCBI Accession #: NP_003693.2
• NCBI GenBank Nucleotide #: NM_003702
• UniProt Accession #: O76081
• NCBI Official Full Name: regulator of G-protein signaling 20 isoform b
• NCBI Official Synonym Full Names: regulator of G protein signaling 20
• NCBI Official Symbol: RGS20
• NCBI Official Synonym Symbols: RGSZ1; ZGAP1; gz-GAP; g(z)GAP
• NCBI Protein Information: regulator of G-protein signaling 20
• UniProt Protein Name: Regulator of G-protein signaling 20
• Protein Family: Regulator of G-protein signaling
• UniProt Gene Name: RGS20
• UniProt Synonym Gene Names: RGSZ1; ZGAP1
• UniProt Entry Name: RGS20_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound forms. This protein selectively binds to G(z)-alpha and G(alpha)-i2 subunits, and regulates their signaling activities. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

RGS20: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G- protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, misc.; GAPs

Chromosomal Location of Human Ortholog: 8q11.23

Cellular Component: cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; GTPase activator activity

Biological Process: regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity