Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZG16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit ZG16 Polyclonal Antibody | anti-ZG16 antibody

ZG16 antibody - middle region

Gene Names
ZG16; JCLN; JCLN1; ZG16A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZG16; Polyclonal Antibody; ZG16 antibody - middle region; anti-ZG16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG
Sequence Length
167
Applicable Applications for anti-ZG16 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZG16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZG16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-ZG16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)
Related Product Information for anti-ZG16 antibody
This is a rabbit polyclonal antibody against ZG16. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
Product Categories/Family for anti-ZG16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
zymogen granule membrane protein 16
NCBI Official Synonym Full Names
zymogen granule protein 16
NCBI Official Symbol
ZG16
NCBI Official Synonym Symbols
JCLN; JCLN1; ZG16A
NCBI Protein Information
zymogen granule membrane protein 16
UniProt Protein Name
Zymogen granule membrane protein 16
UniProt Gene Name
ZG16
UniProt Synonym Gene Names
Zymogen granule protein 16; hZG16
UniProt Entry Name
ZG16_HUMAN

Uniprot Description

ZG16: May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN. Belongs to the jacalin lectin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; zymogen granule membrane; Golgi lumen

Molecular Function: carbohydrate binding

Biological Process: protein transport

Research Articles on ZG16

Similar Products

Product Notes

The ZG16 zg16 (Catalog #AAA3211035) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZG16 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZG16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZG16 zg16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WSDYVGGRNG DLEEIFLHPG ESVIQVSGKY KWYLKKLVFV TDKGRYLSFG. It is sometimes possible for the material contained within the vial of "ZG16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.