Western Blot (WB)
(WB Suggested Anti-RG9MTD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)
Rabbit RG9MTD1 Polyclonal Antibody | anti-TRMT10C antibody
RG9MTD1 antibody - middle region
Gene Names
TRMT10C; HNYA; MRPP1; COXPD30; RG9MTD1
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RG9MTD1; Polyclonal Antibody; RG9MTD1 antibody - middle region; anti-TRMT10C antibody
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG
Sequence Length
403
Applicable Applications for anti-TRMT10C antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RG9MTD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RG9MTD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-RG9MTD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)
Related Product Information for anti-TRMT10C antibody
This is a rabbit polyclonal antibody against RG9MTD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
Target Description: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
Product Categories/Family for anti-TRMT10C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
tRNA methyltransferase 10 homolog C
NCBI Official Synonym Full Names
tRNA methyltransferase 10C, mitochondrial RNase P subunit
NCBI Official Symbol
TRMT10C
NCBI Official Synonym Symbols
HNYA; MRPP1; COXPD30; RG9MTD1
NCBI Protein Information
tRNA methyltransferase 10 homolog C
UniProt Protein Name
Mitochondrial ribonuclease P protein 1
Protein Family
UniProt Gene Name
TRMT10C
UniProt Synonym Gene Names
MRPP1; RG9MTD1; Mitochondrial RNase P protein 1
UniProt Entry Name
MRRP1_HUMAN
NCBI Description
This gene encodes the precursor of a subunit of the mitochondrial ribonuclease P, which is involved in 5' processing of mitochondrial tRNAs. The encoded protein may confer RNA-binding capacity to mitochondrial ribonuclease P and may be essential for transcript processing, RNA modification, translation and mitochondrial respiration. [provided by RefSeq, Nov 2012]
Research Articles on TRMT10C
Similar Products
Product Notes
The TRMT10C trmt10c (Catalog #AAA3205522) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RG9MTD1 antibody - middle region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's RG9MTD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRMT10C trmt10c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKARQIKKEM KAAAREEAKN IKLLETTEED KQKNFLFLRL WDRNMDIAMG. It is sometimes possible for the material contained within the vial of "RG9MTD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
