Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Rest AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Rest Polyclonal Antibody | anti-REST antibody

Rest antibody - middle region

Gene Names
Rest; NRSF; REST4; AA407358; 2610008J04Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rest; Polyclonal Antibody; Rest antibody - middle region; anti-REST antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE
Sequence Length
1082
Applicable Applications for anti-REST antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Rest AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Rest AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-REST antibody
This is a rabbit polyclonal antibody against Rest. It was validated on Western Blot

Target Description: Rest is a transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Rest restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Rest mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118kDa
NCBI Official Full Name
RE1-silencing transcription factor
NCBI Official Synonym Full Names
RE1-silencing transcription factor
NCBI Official Symbol
Rest
NCBI Official Synonym Symbols
NRSF; REST4; AA407358; 2610008J04Rik
NCBI Protein Information
RE1-silencing transcription factor
UniProt Protein Name
RE1-silencing transcription factor
Protein Family
UniProt Gene Name
Rest
UniProt Synonym Gene Names
Nrsf
UniProt Entry Name
REST_MOUSE

Uniprot Description

REST: a transcriptional repressor that binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells during embryonic development. Induced during ageing in human cortical and hippocampal neurons, where it represses genes that promote cell death and induces the expression of stress response genes. Protects neurons from amyloid beta- and oxidative stress-induced toxicity. The deletion of REST in the mouse brain induces age-related neurodegeneration. Restricts the expression of neuronal genes by associating with two distinct corepressors, SIN3A and RCOR1, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. REST activates DYRK1A transcription via a neuron-restricted silencer element in the DYRK1A promoter. Four isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Cell development/differentiation; DNA-binding; C2H2-type zinc finger protein

Cellular Component: protein complex; transcriptional repressor complex; nucleus; chromatin; cytosol

Molecular Function: protein binding; nucleic acid binding; DNA binding; outward rectifier potassium channel activity; metal ion binding; protein complex binding; chromatin binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of calcium ion-dependent exocytosis; transcription, DNA-dependent; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; positive regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of neurogenesis; negative regulation of insulin secretion; regulation of transcription from RNA polymerase II promoter; negative regulation of cell proliferation; negative regulation of neuron differentiation; regulation of transcription, DNA-dependent; negative regulation of aldosterone biosynthetic process; hemopoietic progenitor cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on REST

Similar Products

Product Notes

The REST rest (Catalog #AAA3204200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rest antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rest can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the REST rest for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ANMGMALTND MYDLHELSKA ELAAPQLIML ANVALTGEAS GSCCDYLVGE. It is sometimes possible for the material contained within the vial of "Rest, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.