Western Blot (WB)
(Host: RabbitTarget Name: REEP6Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human REEP6 Polyclonal Antibody | anti-REEP6 antibody
REEP6 Antibody - C-terminal region
Gene Names
REEP6; RP77; DP1L1; TB2L1; Yip2f; REEP6.1; REEP6.2; C19orf32
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
REEP6; Polyclonal Antibody; REEP6 Antibody - C-terminal region; anti-REEP6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK
Sequence Length
184
Applicable Applications for anti-REEP6 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human REEP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: REEP6Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: REEP6Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-REEP6 antibody
This is a rabbit polyclonal antibody against REEP6. It was validated on Western Blot
Target Description: REEP6 may enhance the cell surface expression of odorant receptors.
Target Description: REEP6 may enhance the cell surface expression of odorant receptors.
Product Categories/Family for anti-REEP6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
receptor expression-enhancing protein 6 isoform 2
NCBI Official Synonym Full Names
receptor accessory protein 6
NCBI Official Symbol
REEP6
NCBI Official Synonym Symbols
RP77; DP1L1; TB2L1; Yip2f; REEP6.1; REEP6.2; C19orf32
NCBI Protein Information
receptor expression-enhancing protein 6
UniProt Protein Name
Receptor expression-enhancing protein 6
Protein Family
UniProt Gene Name
REEP6
UniProt Synonym Gene Names
C19orf32; DP1L1
UniProt Entry Name
REEP6_HUMAN
NCBI Description
The protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77. [provided by RefSeq, May 2017]
Research Articles on REEP6
Similar Products
Product Notes
The REEP6 reep6 (Catalog #AAA3218912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REEP6 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's REEP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the REEP6 reep6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYQRVVRPLF LRHHGAVDRI MNDLSGRALD AAAGITRNVK PSQTPQPKDK. It is sometimes possible for the material contained within the vial of "REEP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
