Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RCC1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Rabbit RCC1 Polyclonal Antibody | anti-RCC1 antibody

RCC1 antibody - C-terminal region

Gene Names
RCC1; CHC1; RCC1-I; SNHG3-RCC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RCC1; Polyclonal Antibody; RCC1 antibody - C-terminal region; anti-RCC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKD
Sequence Length
421
Applicable Applications for anti-RCC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RCC1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-RCC1 AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Related Product Information for anti-RCC1 antibody
This is a rabbit polyclonal antibody against RCC1. It was validated on Western Blot

Target Description: RCC1 is a Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA. RCC1-Ran complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA. Plays a key role in nucleo-cytoplasmic transport, mitosis and nuclear-envelope assembly.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
regulator of chromosome condensation isoform c
NCBI Official Synonym Full Names
regulator of chromosome condensation 1
NCBI Official Symbol
RCC1
NCBI Official Synonym Symbols
CHC1; RCC1-I; SNHG3-RCC1
NCBI Protein Information
regulator of chromosome condensation
UniProt Protein Name
Regulator of chromosome condensation
UniProt Gene Name
RCC1
UniProt Synonym Gene Names
CHC1
UniProt Entry Name
RCC1_HUMAN

Uniprot Description

RCC1: a guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP for GTP. Localised generation of Ran-GTP by RCC1 on chromatin is critical for nucleocytoplasmic transport, mitotic spindle assembly and nuclear envelope formation. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA. RCC1-Ran complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA. Plays a key role in nucleo- cytoplasmic transport, mitosis and nuclear-envelope assembly. Interacts with ARRB2; the interaction is detected in the nucleus upon OR1D2 stimulation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Ras; Cell cycle regulation

Chromosomal Location of Human Ortholog: 1p36.1

Cellular Component: nucleoplasm; nuclear membrane; condensed nuclear chromosome; cytoplasm; nuclear chromatin; nucleus

Molecular Function: protein binding; nucleosomal DNA binding; Ran guanyl-nucleotide exchange factor activity; histone binding; chromatin binding

Biological Process: mitosis; mitotic spindle organization and biogenesis; viral reproduction; cell division; regulation of mitosis; spindle assembly; G1/S transition of mitotic cell cycle; chromosome segregation

Research Articles on RCC1

Similar Products

Product Notes

The RCC1 rcc1 (Catalog #AAA3215173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCC1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RCC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RCC1 rcc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AWGMGTNYQL GTGQDEDAWS PVEMMGKQLE NRVVLSVSSG GQHTVLLVKD. It is sometimes possible for the material contained within the vial of "RCC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.