Western Blot (WB)
(Host: RabbitTarget Name: RBP7Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human RBP7 Polyclonal Antibody | anti-RBP7 antibody
RBP7 Antibody - middle region
Gene Names
RBP7; CRBP4; CRABP4; CRBPIV
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RBP7; Polyclonal Antibody; RBP7 Antibody - middle region; anti-RBP7 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: TIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKG
Sequence Length
134
Applicable Applications for anti-RBP7 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RBP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RBP7Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RBP7Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RBP7 antibody
retinol binding protein 7, cellular
Target Description: Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM, May 2004]
Target Description: Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM, May 2004]
Product Categories/Family for anti-RBP7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa
NCBI Official Full Name
retinoid-binding protein 7
NCBI Official Synonym Full Names
retinol binding protein 7
NCBI Official Symbol
RBP7
NCBI Official Synonym Symbols
CRBP4; CRABP4; CRBPIV
NCBI Protein Information
retinoid-binding protein 7
UniProt Protein Name
Retinoid-binding protein 7
Protein Family
UniProt Gene Name
RBP7
UniProt Synonym Gene Names
CRABP4; CRBP4; CRABP-IV
UniProt Entry Name
RET7_HUMAN
NCBI Description
The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016]
Uniprot Description
RBP7: Intracellular transport of retinol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Chromosomal Location of Human Ortholog: 1p36.22
Cellular Component: cytoplasm
Molecular Function: transporter activity; retinol binding; retinal binding
Biological Process: transport
Research Articles on RBP7
Similar Products
Product Notes
The RBP7 rbp7 (Catalog #AAA3210805) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBP7 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBP7 rbp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIHTNSSLRN YFVKFKVGEE FDEDNRGLDN RKCKSLVIWD NDRLTCIQKG. It is sometimes possible for the material contained within the vial of "RBP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
