Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RBP7 is 1 ng/ml as a capture antibody.)

Mouse RBP7 Monoclonal Antibody | anti-RBP7 antibody

RBP7 (Retinol Binding Protein 7, Cellular, CRBP4, CRBPIV, MGC70641) (PE)

Gene Names
RBP7; CRBP4; CRBPIV
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
RBP7; Monoclonal Antibody; RBP7 (Retinol Binding Protein 7; Cellular; CRBP4; CRBPIV; MGC70641) (PE); Retinol Binding Protein 7; MGC70641; anti-RBP7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes RBP7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RBP7 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RBP7 (NP_443192.1, 35aa-134aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBP7 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBP7 is 1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of RBP7 expression in transfected 293T cell line by RBP7 monoclonal antibody (M01), clone 4F4.Lane 1: RBP7 transfected lysate (Predicted MW: 15.5 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RBP7 expression in transfected 293T cell line by RBP7 monoclonal antibody (M01), clone 4F4.Lane 1: RBP7 transfected lysate (Predicted MW: 15.5 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBP7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RBP7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBP7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RBP7 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RBP7 antibody
Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism. [supplied by OMIM]
Product Categories/Family for anti-RBP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,536 Da
NCBI Official Full Name
retinoid-binding protein 7
NCBI Official Synonym Full Names
retinol binding protein 7, cellular
NCBI Official Symbol
RBP7
NCBI Official Synonym Symbols
CRBP4; CRBPIV
NCBI Protein Information
retinoid-binding protein 7; CRABP-IV; CRABP4; cellular retinoic acid-binding protein 4; cellular retinoic acid-binding protein IV; putative cellular retinol-binding protein CRBP IV; retinoid binding protein 7
UniProt Protein Name
Retinoid-binding protein 7
Protein Family
UniProt Gene Name
RBP7
UniProt Synonym Gene Names
CRABP4; CRBP4; CRABP-IV
UniProt Entry Name
RET7_HUMAN

NCBI Description

Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM, May 2004]

Uniprot Description

RBP7: Intracellular transport of retinol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: cytoplasm

Molecular Function: transporter activity; retinol binding; retinal binding

Biological Process: transport

Research Articles on RBP7

Similar Products

Product Notes

The RBP7 rbp7 (Catalog #AAA6187332) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RBP7 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBP7 rbp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBP7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.