Rabbit anti-Human RBP4 Polyclonal Antibody | anti-RBP4 antibody

RBP4 (Retinol-binding Protein 4, Plasma Retinol-binding Protein, PRBP, RBP, PRO2222) (HRP)

Cat. Num. AAA6392192

• Gene Names: RBP4; RDCCAS
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBP4; Polyclonal Antibody; RBP4 (Retinol-binding Protein 4; Plasma Retinol-binding Protein; PRBP; RBP; PRO2222) (HRP); anti-RBP4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RBP4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-RBP4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RBP4, aa1-201 (NP_006735.2).
• Immunogen Sequence: MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBP4 expression in transfected 293T cell line by RBP4 polyclonal antibody. Lane 1: RBP4 transfected lysate (23kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RBP4 antibody

Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.

Product Categories/Family for anti-RBP4 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 55743122
• NCBI GeneID: 5950
• NCBI Accession #: NP_006735.2
• NCBI GenBank Nucleotide #: NM_006744.3
• UniProt Accession #: P02753; O43478; O43479; Q5VY24; Q8WWA3; Q9P178; D3DR38
• Molecular Weight: 23,010 Da
• NCBI Official Full Name: retinol-binding protein 4
• NCBI Official Synonym Full Names: retinol binding protein 4, plasma
• NCBI Official Symbol: RBP4
• NCBI Official Synonym Symbols: RDCCAS
• NCBI Protein Information: retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial
• UniProt Protein Name: Retinol-binding protein 4
• Protein Family: Retinol-binding protein
• UniProt Gene Name: RBP4
• UniProt Synonym Gene Names: PRBP; RBP
• UniProt Entry Name: RET4_HUMAN

NCBI Description

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008]

Uniprot Description

RBP4: Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli. Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency). This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium. Belongs to the calycin superfamily. Lipocalin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: extracellular space; protein complex; extracellular region; cytosol

Molecular Function: protein binding; protein heterodimerization activity; retinol binding; retinal binding

Biological Process: phototransduction, visible light; retinal metabolic process; heart development; embryonic skeletal development; maintenance of gastrointestinal epithelium; glucose homeostasis; uterus development; response to insulin stimulus; embryonic organ morphogenesis; negative regulation of cardiac muscle cell proliferation; retinol metabolic process; detection of light stimulus involved in visual perception; retinoid metabolic process; female genitalia morphogenesis; cardiac muscle development; response to retinoic acid; urinary bladder development; male gonad development; vagina development; positive regulation of insulin secretion; positive regulation of immunoglobulin secretion; gluconeogenesis; response to ethanol; eye development; embryonic retina morphogenesis in camera-type eye; spermatogenesis; lung development

Disease: Retinal Dystrophy, Iris Coloboma, And Comedogenic Acne Syndrome; Microphthalmia, Isolated, With Coloboma 10