Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RBP4 expression in transfected 293T cell line by RBP4 polyclonal antibody. Lane 1: RBP4 transfected lysate (23kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RBP4 Polyclonal Antibody | anti-RBP4 antibody

RBP4 (Retinol-binding Protein 4, Plasma Retinol-binding Protein, PRBP, RBP, PRO2222) (Biotin)

Gene Names
RBP4; RDCCAS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBP4; Polyclonal Antibody; RBP4 (Retinol-binding Protein 4; Plasma Retinol-binding Protein; PRBP; RBP; PRO2222) (Biotin); anti-RBP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RBP4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RBP4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RBP4, aa1-201 (NP_006735.2).
Immunogen Sequence
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBP4 expression in transfected 293T cell line by RBP4 polyclonal antibody. Lane 1: RBP4 transfected lysate (23kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RBP4 expression in transfected 293T cell line by RBP4 polyclonal antibody. Lane 1: RBP4 transfected lysate (23kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RBP4 antibody
Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
Product Categories/Family for anti-RBP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,010 Da
NCBI Official Full Name
retinol-binding protein 4
NCBI Official Synonym Full Names
retinol binding protein 4, plasma
NCBI Official Symbol
RBP4
NCBI Official Synonym Symbols
RDCCAS
NCBI Protein Information
retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial
UniProt Protein Name
Retinol-binding protein 4
Protein Family
UniProt Gene Name
RBP4
UniProt Synonym Gene Names
PRBP; RBP
UniProt Entry Name
RET4_HUMAN

NCBI Description

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008]

Uniprot Description

RBP4: Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli. Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency). This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium. Belongs to the calycin superfamily. Lipocalin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: extracellular space; protein complex; extracellular region; cytosol

Molecular Function: protein binding; protein heterodimerization activity; retinol binding; retinal binding

Biological Process: phototransduction, visible light; retinal metabolic process; heart development; embryonic skeletal development; maintenance of gastrointestinal epithelium; glucose homeostasis; uterus development; response to insulin stimulus; embryonic organ morphogenesis; negative regulation of cardiac muscle cell proliferation; retinol metabolic process; detection of light stimulus involved in visual perception; retinoid metabolic process; female genitalia morphogenesis; cardiac muscle development; response to retinoic acid; urinary bladder development; male gonad development; vagina development; positive regulation of insulin secretion; positive regulation of immunoglobulin secretion; gluconeogenesis; response to ethanol; eye development; embryonic retina morphogenesis in camera-type eye; spermatogenesis; lung development

Disease: Retinal Dystrophy, Iris Coloboma, And Comedogenic Acne Syndrome; Microphthalmia, Isolated, With Coloboma 10

Research Articles on RBP4

Similar Products

Product Notes

The RBP4 rbp4 (Catalog #AAA6392190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBP4 (Retinol-binding Protein 4, Plasma Retinol-binding Protein, PRBP, RBP, PRO2222) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBP4 rbp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.