Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RBM9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateRBFOX2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Rabbit RBM9 Polyclonal Antibody | anti-RBFOX2 antibody

RBM9 antibody - middle region

Gene Names
RBFOX2; RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3
Reactivity
Cow, Goat, Horse, Human, Mouse, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBM9; Polyclonal Antibody; RBM9 antibody - middle region; anti-RBFOX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Mouse, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
Sequence Length
367
Applicable Applications for anti-RBFOX2 antibody
Western Blot (WB)
Homology
Cow: 75%; Goat: 76%; Horse: 85%; Human: 100%; Mouse: 93%; Yeast: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RBM9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RBM9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateRBFOX2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Western Blot (WB) (WB Suggested Anti-RBM9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateRBFOX2 is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-RBFOX2 antibody
This is a rabbit polyclonal antibody against RBM9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
RNA binding protein fox-1 homolog 2 isoform 2
NCBI Official Synonym Full Names
RNA binding fox-1 homolog 2
NCBI Official Symbol
RBFOX2
NCBI Official Synonym Symbols
RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3
NCBI Protein Information
RNA binding protein fox-1 homolog 2
UniProt Protein Name
RNA binding protein fox-1 homolog 2
Protein Family
UniProt Gene Name
RBFOX2
UniProt Synonym Gene Names
FOX2; HRNBP2; RBM9; RTA
UniProt Entry Name
RFOX2_HUMAN

NCBI Description

This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

RBM9: RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. 10 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Nuclear receptor co-regulator; Transcription, coactivator/corepressor; RNA splicing

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: mRNA binding; protein binding; RNA binding; nucleotide binding; transcription factor binding; transcription corepressor activity

Biological Process: estrogen receptor signaling pathway; RNA metabolic process; RNA splicing; dendrite morphogenesis; radial glia guided migration of Purkinje cell; neuromuscular process controlling balance; mRNA processing; negative regulation of transcription, DNA-dependent; regulation of alternative nuclear mRNA splicing, via spliceosome; regulation of cell proliferation

Research Articles on RBFOX2

Similar Products

Product Notes

The RBFOX2 rbfox2 (Catalog #AAA3205461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM9 antibody - middle region reacts with Cow, Goat, Horse, Human, Mouse, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's RBM9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBFOX2 rbfox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPTAIPAYPG VDMQPTDMHS LLLQPQPPLL QPLQPLTVTV MAGCTQPTPT. It is sometimes possible for the material contained within the vial of "RBM9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.