Rabbit RBM38 Polyclonal Antibody | anti-RBM38 antibody

RBM38 antibody - N-terminal region

Cat. Num. AAA3205514

• Gene Names: RBM38; RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: RBM38; Polyclonal Antibody; RBM38 antibody - N-terminal region; anti-RBM38 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER
• Sequence Length: 239

• Applicable Applications for anti-RBM38 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 79%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM38
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RBM38 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: RBM38Sample Tissue: Human A549Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-RBM38 Antibody Titration: 0.2-1 ug/mlPositive Control: RPMI 8226 cell lysateRBM38 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Related Product Information for anti-RBM38 antibody

This is a rabbit polyclonal antibody against RBM38. It was validated on Western Blot and immunohistochemistry

Target Description: RBM38 is a probable RNA-binding protein.

Product Categories/Family for anti-RBM38 antibody

Polyclonal; RNA Binding Proteins; Transcription Regulation; DNA/RNA/Protein Interactions; Immunohistochemistry; Transcription Factors; Cell Differentiation

NCBI and Uniprot Product Information

• NCBI GI #: 34577107
• NCBI GeneID: 55544
• NCBI Accession #: NP_059965
• NCBI GenBank Nucleotide #: NM_017495
• UniProt Accession #: Q9H0Z9
• Molecular Weight: 26kDa
• NCBI Official Full Name: RNA-binding protein 38 isoform a
• NCBI Official Synonym Full Names: RNA binding motif protein 38
• NCBI Official Symbol: RBM38
• NCBI Official Synonym Symbols: RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
• NCBI Protein Information: RNA-binding protein 38
• UniProt Protein Name: RNA-binding protein 38
• Protein Family: RNA-binding protein
• UniProt Gene Name: RBM38
• UniProt Synonym Gene Names: RNPC1; SEB4

Uniprot Description

RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.