Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RBM38 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit RBM38 Polyclonal Antibody | anti-RBM38 antibody

RBM38 antibody - N-terminal region

Gene Names
RBM38; RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RBM38; Polyclonal Antibody; RBM38 antibody - N-terminal region; anti-RBM38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER
Sequence Length
239
Applicable Applications for anti-RBM38 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 79%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBM38
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RBM38 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-RBM38 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: RBM38Sample Tissue: Human A549Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RBM38Sample Tissue: Human A549Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-RBM38 Antibody Titration: 0.2-1 ug/mlPositive Control: RPMI 8226 cell lysateRBM38 is supported by BioGPS gene expression data to be expressed in RPMI 8226)

Western Blot (WB) (WB Suggested Anti-RBM38 Antibody Titration: 0.2-1 ug/mlPositive Control: RPMI 8226 cell lysateRBM38 is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-RBM38 antibody
This is a rabbit polyclonal antibody against RBM38. It was validated on Western Blot and immunohistochemistry

Target Description: RBM38 is a probable RNA-binding protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
RNA-binding protein 38 isoform a
NCBI Official Synonym Full Names
RNA binding motif protein 38
NCBI Official Symbol
RBM38
NCBI Official Synonym Symbols
RNPC1; SEB4B; SEB4D; HSRNASEB; dJ800J21.2
NCBI Protein Information
RNA-binding protein 38
UniProt Protein Name
RNA-binding protein 38
Protein Family
UniProt Gene Name
RBM38
UniProt Synonym Gene Names
RNPC1; SEB4

Uniprot Description

RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.

Research Articles on RBM38

Similar Products

Product Notes

The RBM38 rbm38 (Catalog #AAA3205514) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM38 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RBM38 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RBM38 rbm38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPYHTTDASL RKYFEGFGDI EEAVVITDRQ TGKSRGYGFV TMADRAAAER. It is sometimes possible for the material contained within the vial of "RBM38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.