Western Blot (WB)
(Host: RabbitTarget Name: RBM10Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human RBM10 Polyclonal Antibody | anti-RBM10 antibody
RBM10 Antibody - N-terminal region
Gene Names
RBM10; S1-1; TARPS; GPATC9; ZRANB5; GPATCH9; DXS8237E
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RBM10; Polyclonal Antibody; RBM10 Antibody - N-terminal region; anti-RBM10 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEE
Sequence Length
853
Applicable Applications for anti-RBM10 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RBM10Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RBM10Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RBM10 antibody
This gene encodes a nuclear protein that belongs to a family proteins that contain an RNA-binding motif. The encoded protein associates with hnRNP proteins and may be involved in regulating alternative splicing. Defects in this gene are the cause of the X-linked recessive disorder, TARP syndrome. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-RBM10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93 kDa
NCBI Official Full Name
RNA-binding protein 10 isoform 3
NCBI Official Synonym Full Names
RNA binding motif protein 10
NCBI Official Symbol
RBM10
NCBI Official Synonym Symbols
S1-1; TARPS; GPATC9; ZRANB5; GPATCH9; DXS8237E
NCBI Protein Information
RNA-binding protein 10
UniProt Protein Name
RNA-binding protein 10
Protein Family
UniProt Gene Name
RBM10
UniProt Synonym Gene Names
DXS8237E; GPATC9; GPATCH9; KIAA0122; S1-1
UniProt Entry Name
RBM10_HUMAN
NCBI Description
This gene encodes a nuclear protein that belongs to a family proteins that contain an RNA-binding motif. The encoded protein associates with hnRNP proteins and may be involved in regulating alternative splicing. Defects in this gene are the cause of the X-linked recessive disorder, TARP syndrome. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2011]
Uniprot Description
May be involved in post-transcriptional processing, most probably in mRNA splicing. Binds to RNA homopolymers, with a preference for poly(G) and poly(U) and little for poly(A) ().
Research Articles on RBM10
Similar Products
Product Notes
The RBM10 rbm10 (Catalog #AAA3219822) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM10 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBM10 rbm10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRYGATDRSQ DDGGENRSRD HDYRDMDYRS YPREYGSQEG KHDYDDSSEE. It is sometimes possible for the material contained within the vial of "RBM10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
