Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RBM10 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of collecting tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit RBM10 Polyclonal Antibody | anti-RBM10 antibody

RBM10 antibody - N-terminal region

Gene Names
RBM10; S1-1; TARPS; GPATC9; ZRANB5; GPATCH9; DXS8237E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RBM10; Polyclonal Antibody; RBM10 antibody - N-terminal region; anti-RBM10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRRRRRRHRH
Sequence Length
930
Applicable Applications for anti-RBM10 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RBM10 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of collecting tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-RBM10 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of collecting tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-RBM10 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-RBM10 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/mlELISA Titer: 1:62500Positive Control: Daudi cell lysateRBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

Western Blot (WB) (WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/mlELISA Titer: 1:62500Positive Control: Daudi cell lysateRBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)
Related Product Information for anti-RBM10 antibody
This is a rabbit polyclonal antibody against RBM10. It was validated on Western Blot and immunohistochemistry

Target Description: RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104kDa
NCBI Official Full Name
RNA-binding protein 10 isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein 10
NCBI Official Symbol
RBM10
NCBI Official Synonym Symbols
S1-1; TARPS; GPATC9; ZRANB5; GPATCH9; DXS8237E
NCBI Protein Information
RNA-binding protein 10
UniProt Protein Name
RNA-binding protein 10
Protein Family
UniProt Gene Name
RBM10
UniProt Synonym Gene Names
DXS8237E; GPATC9; GPATCH9; KIAA0122; S1-1
UniProt Entry Name
RBM10_HUMAN

NCBI Description

This gene encodes a nuclear protein that belongs to a family proteins that contain an RNA-binding motif. The encoded protein associates with hnRNP proteins and may be involved in regulating alternative splicing. Defects in this gene are the cause of the X-linked recessive disorder, TARP syndrome. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Mar 2011]

Uniprot Description

May be involved in post-transcriptional processing, most probably in mRNA splicing. Binds to RNA homopolymers, with a preference for poly(G) and poly(U) and little for poly(A) ().

Research Articles on RBM10

Similar Products

Product Notes

The RBM10 rbm10 (Catalog #AAA3200167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM10 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RBM10 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RBM10 rbm10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDYRSYPREY GSQEGKHDYD DSSEEQSAED SYEASPGSET QRRRRRRHRH. It is sometimes possible for the material contained within the vial of "RBM10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.