Rabbit anti-Human RBCK1 Polyclonal Antibody | anti-RBCK1 antibody

RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati

Cat. Num. AAA6005147

• Gene Names: RBCK1; XAP3; XAP4; HOIL1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3
• Reactivity: Human
• Applications: Western Blot, Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: RBCK1; Polyclonal Antibody; RBCK1 (C20orf18; RNF54; UBCE7IP3; XAP3; XAP4; RanBP-type and C3HC4-type Zinc Finger-containing Protein 1; HBV-associated Factor 4; Heme-oxidized IRP2 Ubiquitin Ligase 1; Hepatitis B Virus X-associated Protein 4; RING Finger Protein 54; Ubiquitin-conjugati; Anti -RBCK1 (C20orf18; anti-RBCK1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RBCK1.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH

• Applicable Applications for anti-RBCK1 antibody: Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: Suitable for use in Western Blot and Immunoprecipitation.
• Immunogen: Full-length human RBCK1, aa1-230 (ENSP00000290048).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RBCK1 rabbit polyclonal antibody. Western Blot analysis of RBCK1 expression in human stomach.)

Western Blot (WB)

(Western Blot analysis of RBCK1 expression in transfected 293T cell line by RBCK1 polyclonal antibody. Lane 1: RBCK1 transfected lysate (25.7kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of RBCK1 transfected lysate using RBCK1 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with RBCK1 mouse polyclonal antibody.)

Related Product Information for anti-RBCK1 antibody

The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq].

Product Categories/Family for anti-RBCK1 antibody

Antibodies; Abs to Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 144953898
• NCBI GeneID: 10616
• NCBI Accession #: NP_112506.2
• NCBI GenBank Nucleotide #: NM_031229.2
• UniProt Accession #: Q9BYM8; O95623; Q86SL2; Q96BS3; Q9BYM9
• Molecular Weight: 57,572 Da
• NCBI Official Full Name: ranBP-type and C3HC4-type zinc finger-containing protein 1 isoform 2
• NCBI Official Synonym Full Names: RanBP-type and C3HC4-type zinc finger containing 1
• NCBI Official Symbol: RBCK1
• NCBI Official Synonym Symbols: XAP3; XAP4; HOIL1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3
• NCBI Protein Information: ranBP-type and C3HC4-type zinc finger-containing protein 1; RING finger protein 54; HBV associated factor 4; HBV-associated factor 4; RBCC protein interacting with PKC1; heme-oxidized IRP2 ubiquitin ligase 1; hepatitis B virus X-associated protein 4; ubiquitin conjugating enzyme 7 interacting protein 3; ubiquitin-conjugating enzyme 7-interacting protein 3
• UniProt Protein Name: RanBP-type and C3HC4-type zinc finger-containing protein 1
• Protein Family: RanBP-type and C3HC4-type zinc finger-containing protein
• UniProt Gene Name: RBCK1
• UniProt Synonym Gene Names: C20orf18; RNF54; UBCE7IP3; XAP3; XAP4; HOIL-1
• UniProt Entry Name: HOIL1_HUMAN

NCBI Description

The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

RBCK1: a E3 ubiquitin-protein ligase that contains a zf-RanBP (Zn-finger in Ran binding protein) and a zf-C3HC4 (RING finger) domain. Phosphorylation apparently reduces its E3 activity. Functions as a transcriptional activator. Its nuclear translocation is prevented by binding to a splice-variant of RBCK1 that lacks the RING finger domain. Interacts with PKCB1, PKCZ, and accepts ubiquitin from E2 ubiquitin-conjugating enzymes including UBE2L3. Interacts with PKCH. Interacts with the HBV pX/HBx protein, which is required to activate transcription of the viral genome. Three splice-variant isoforms of the human protein have been reported.

Protein type: Ubiquitin ligase; Ubiquitin conjugating system; Ligase; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 20p13

Molecular Function: protein binding; ubiquitin binding; zinc ion binding; ubiquitin-protein ligase activity; transcription factor activity; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein polyubiquitination; viral reproduction; inhibition of NF-kappaB transcription factor; positive regulation of NF-kappaB import into nucleus; T cell receptor signaling pathway; activation of NF-kappaB transcription factor

Disease: Polyglucosan Body Myopathy, Early-onset, With Or Without Immunodeficiency