Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human RBCK1 Monoclonal Antibody | anti-RBCK1 antibody

RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati

Gene Names
RBCK1; XAP3; XAP4; HOIL1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RBCK1; Monoclonal Antibody; RBCK1 (C20orf18; RNF54; UBCE7IP3; XAP3; XAP4; RanBP-type and C3HC4-type Zinc Finger-containing Protein 1; HBV-associated Factor 4; Heme-oxidized IRP2 Ubiquitin Ligase 1; Hepatitis B Virus X-associated Protein 4; RING Finger Protein 54; Ubiquitin-conjugati; Anti -RBCK1 (C20orf18; anti-RBCK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C3
Specificity
Recognizes human C20orf18.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ
Applicable Applications for anti-RBCK1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa3-99 from C20orf18 (NP_006453) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB)

(Western Blot analysis of C20orf18 expression in transfected 293T cell line by C20orf18 monoclonal antibody.|Lane 1: C20orf18 transfected lysate (25.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C20orf18 expression in transfected 293T cell line by C20orf18 monoclonal antibody.|Lane 1: C20orf18 transfected lysate (25.7kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBCK1 on HeLa cell . [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RBCK1 on HeLa cell . [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged C20orf18 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C20orf18 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-RBCK1 antibody
The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq].
Product Categories/Family for anti-RBCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,572 Da
NCBI Official Full Name
ranBP-type and C3HC4-type zinc finger-containing protein 1 isoform 2
NCBI Official Synonym Full Names
RanBP-type and C3HC4-type zinc finger containing 1
NCBI Official Symbol
RBCK1
NCBI Official Synonym Symbols
XAP3; XAP4; HOIL1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3
NCBI Protein Information
ranBP-type and C3HC4-type zinc finger-containing protein 1; RING finger protein 54; HBV associated factor 4; HBV-associated factor 4; RBCC protein interacting with PKC1; heme-oxidized IRP2 ubiquitin ligase 1; hepatitis B virus X-associated protein 4; ubiquitin conjugating enzyme 7 interacting protein 3; ubiquitin-conjugating enzyme 7-interacting protein 3
UniProt Protein Name
RanBP-type and C3HC4-type zinc finger-containing protein 1
UniProt Gene Name
RBCK1
UniProt Synonym Gene Names
C20orf18; RNF54; UBCE7IP3; XAP3; XAP4; HOIL-1
UniProt Entry Name
HOIL1_HUMAN

NCBI Description

The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

RBCK1: a E3 ubiquitin-protein ligase that contains a zf-RanBP (Zn-finger in Ran binding protein) and a zf-C3HC4 (RING finger) domain. Phosphorylation apparently reduces its E3 activity. Functions as a transcriptional activator. Its nuclear translocation is prevented by binding to a splice-variant of RBCK1 that lacks the RING finger domain. Interacts with PKCB1, PKCZ, and accepts ubiquitin from E2 ubiquitin-conjugating enzymes including UBE2L3. Interacts with PKCH. Interacts with the HBV pX/HBx protein, which is required to activate transcription of the viral genome. Three splice-variant isoforms of the human protein have been reported.

Protein type: Ligase; EC 6.3.2.-; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 20p13

Molecular Function: protein binding; ubiquitin binding; zinc ion binding; ubiquitin-protein ligase activity; transcription factor activity; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; inhibition of NF-kappaB transcription factor; positive regulation of NF-kappaB import into nucleus; T cell receptor signaling pathway; activation of NF-kappaB transcription factor

Disease: Polyglucosan Body Myopathy, Early-onset, With Or Without Immunodeficiency

Research Articles on RBCK1

Similar Products

Product Notes

The RBCK1 rbck1 (Catalog #AAA6011947) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBCK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the RBCK1 rbck1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TATPDGREDQ ERLWVSVEDA QMHTVTIWLT VRPDMTVASL KDMVFLDYGF PPVLQQWVIG QRLARDQETL HSHGVRQNGD SAYLYLLSAR NTSLNPQ. It is sometimes possible for the material contained within the vial of "RBCK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.