Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HOIL1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RBCK1 Polyclonal Antibody | anti-RBCK1 antibody

RBCK1 Antibody - middle region

Gene Names
RBCK1; XAP3; XAP4; HOIL1; PBMEI; PGBM1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBCK1; Polyclonal Antibody; RBCK1 Antibody - middle region; anti-RBCK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Sequence Length
230
Applicable Applications for anti-RBCK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human HOIL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HOIL1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HOIL1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RBCK1 antibody
This is a rabbit polyclonal antibody against HOIL1. It was validated on Western Blot

Target Description: The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms.
Product Categories/Family for anti-RBCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
ranBP-type and C3HC4-type zinc finger-containing protein 1 isoform 2
NCBI Official Synonym Full Names
RANBP2-type and C3HC4-type zinc finger containing 1
NCBI Official Symbol
RBCK1
NCBI Official Synonym Symbols
XAP3; XAP4; HOIL1; PBMEI; PGBM1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3
NCBI Protein Information
ranBP-type and C3HC4-type zinc finger-containing protein 1
UniProt Protein Name
RanBP-type and C3HC4-type zinc finger-containing protein 1
UniProt Gene Name
RBCK1
UniProt Synonym Gene Names
C20orf18; RNF54; UBCE7IP3; XAP3; XAP4; HOIL-1
UniProt Entry Name
HOIL1_HUMAN

NCBI Description

The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

RBCK1: a E3 ubiquitin-protein ligase that contains a zf-RanBP (Zn-finger in Ran binding protein) and a zf-C3HC4 (RING finger) domain. Phosphorylation apparently reduces its E3 activity. Functions as a transcriptional activator. Its nuclear translocation is prevented by binding to a splice-variant of RBCK1 that lacks the RING finger domain. Interacts with PKCB1, PKCZ, and accepts ubiquitin from E2 ubiquitin-conjugating enzymes including UBE2L3. Interacts with PKCH. Interacts with the HBV pX/HBx protein, which is required to activate transcription of the viral genome. Three splice-variant isoforms of the human protein have been reported.

Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 20p13

Molecular Function: protein binding; ubiquitin binding; zinc ion binding; ubiquitin-protein ligase activity; transcription factor activity; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein polyubiquitination; viral reproduction; inhibition of NF-kappaB transcription factor; positive regulation of NF-kappaB import into nucleus; T cell receptor signaling pathway; activation of NF-kappaB transcription factor

Disease: Polyglucosan Body Myopathy, Early-onset, With Or Without Immunodeficiency

Research Articles on RBCK1

Similar Products

Product Notes

The RBCK1 rbck1 (Catalog #AAA3219565) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBCK1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBCK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBCK1 rbck1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQRERQLRML EDLGFKDLTL QPRGPLEPGP PKPGVPQEPG RGQPDAVPEP. It is sometimes possible for the material contained within the vial of "RBCK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.