Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RARRES2 rabbit polyclonal antibody. Western Blot analysis of RARRES2 expression in mouse testis.)

Rabbit anti-Human, Mouse RARRES2 Polyclonal Antibody | anti-RARRES2 antibody

RARRES2 (TIG2, Retinoic Acid Receptor Responder Protein 2, RAR-responsive Protein TIG2, Tazarotene-induced Gene 2 Protein) APC

Gene Names
RARRES2; TIG2; HP10433
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RARRES2; Polyclonal Antibody; RARRES2 (TIG2; Retinoic Acid Receptor Responder Protein 2; RAR-responsive Protein TIG2; Tazarotene-induced Gene 2 Protein) APC; anti-RARRES2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RARRES2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RARRES2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RARRES2, aa1-163 (NP_002880.1).
Immunogen Sequence
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RARRES2 rabbit polyclonal antibody. Western Blot analysis of RARRES2 expression in mouse testis.)

Western Blot (WB) (RARRES2 rabbit polyclonal antibody. Western Blot analysis of RARRES2 expression in mouse testis.)

Western Blot (WB)

(Western Blot analysis of RARRES2 expression in transfected 293T cell line by RARRES2 polyclonal antibody. Lane 1: RARRES2 transfected lysate (18.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RARRES2 expression in transfected 293T cell line by RARRES2 polyclonal antibody. Lane 1: RARRES2 transfected lysate (18.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RARRES2 antibody
This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein.
Product Categories/Family for anti-RARRES2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
retinoic acid receptor responder protein 2
NCBI Official Synonym Full Names
retinoic acid receptor responder 2
NCBI Official Symbol
RARRES2
NCBI Official Synonym Symbols
TIG2; HP10433
NCBI Protein Information
retinoic acid receptor responder protein 2
UniProt Protein Name
Retinoic acid receptor responder protein 2
UniProt Gene Name
RARRES2
UniProt Synonym Gene Names
TIG2
UniProt Entry Name
RARR2_HUMAN

NCBI Description

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]

Uniprot Description

RARRES2: Inhibited in psoriatic lesions. Activated by tazarotene in skin rafts and in the epidermis of psoriatic lesions.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: extracellular matrix; extracellular region

Molecular Function: protein binding; receptor binding

Biological Process: positive regulation of chemotaxis; in utero embryonic development; brown fat cell differentiation; positive regulation of fat cell differentiation; positive regulation of protein amino acid phosphorylation; inflammatory response; retinoid metabolic process; chemotaxis; embryonic gut development; regulation of lipid catabolic process

Research Articles on RARRES2

Similar Products

Product Notes

The RARRES2 rarres2 (Catalog #AAA6392013) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RARRES2 (TIG2, Retinoic Acid Receptor Responder Protein 2, RAR-responsive Protein TIG2, Tazarotene-induced Gene 2 Protein) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RARRES2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RARRES2 rarres2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RARRES2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.