Western Blot (WB)
(SLC44A3 antibody (MBS5302487) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Mouse SLC44A3 Polyclonal Antibody | anti-SLC44A3 antibody
SLC44A3 antibody
Gene Names
SLC44A3; CTL3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC44A3; Polyclonal Antibody; SLC44A3 antibody; Polyclonal SLC44A3; Anti-SLC44A3; SLCA3-44; Solute Carrier Family 44 Member 3; CTL3; MGC45474; SLCA3 44; anti-SLC44A3 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
SLC44A3 antibody was raised against the N terminal of SLC44A3
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC44A3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
677
Applicable Applications for anti-SLC44A3 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.
Cross-Reactivity
Human,Mouse
Immunogen
SLC44A3 antibody was raised using the N terminal of SLC44A3 corresponding to a region with amino acids MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(SLC44A3 antibody (MBS5302487) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(SLC44A3 antibody (MBS5302487) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC44A3 antibody
Rabbit polyclonal SLC44A3 antibody raised against the N terminal of SLC44A3
Product Categories/Family for anti-SLC44A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
68 kDa (MW of target protein)
NCBI Official Full Name
SLC44A3 protein, partial
NCBI Official Synonym Full Names
solute carrier family 44, member 3
NCBI Official Symbol
SLC44A3
NCBI Official Synonym Symbols
CTL3
NCBI Protein Information
choline transporter-like protein 3
UniProt Protein Name
Choline transporter-like protein 3
Protein Family
UniProt Gene Name
SLC44A3
UniProt Synonym Gene Names
CTL3
UniProt Entry Name
CTL3_HUMAN
Uniprot Description
SLC44A3: Belongs to the CTL (choline transporter-like) family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Transporter; Transporter, SLC family; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 1p21.3
Cellular Component: plasma membrane; integral to membrane
Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidylcholine biosynthetic process; transmembrane transport
Research Articles on SLC44A3
Similar Products
Product Notes
The SLC44A3 slc44a3 (Catalog #AAA5302487) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC44A3 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC44A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC44A3 slc44a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC44A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
