<
Immunohistochemistry (IHC)
(Rabbit Anti-GNB2L1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,MembranePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Rabbit RACK1 Polyclonal Antibody | anti-RACK1 antibody
RACK1 Antibody - C-terminal region
Gene Names
RACK1; H12.3; HLC-7; PIG21; GNB2L1; Gnb2-rs1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RACK1; Polyclonal Antibody; RACK1 Antibody - C-terminal region; anti-RACK1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
Sequence Length
317
Applicable Applications for anti-RACK1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-GNB2L1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,MembranePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Immunohistochemistry (IHC)
(Rabbit Anti-GNB2L1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,MembranePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Western Blot (WB)
(Sample Type: Human MCF-7Sample Type:MCF-7 WT a whole cell lysates (110UG)Primary Dilution:1.5mg/mLSecondary Antibody:LI-COR Donkey anti-rabbitSecondary Dilution:1:10,000GNB2L1 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(Sample Type: Human MCF-7Sample Type:MCF-7 WT a whole cell lysates (110UG)Primary Dilution:1.5mg/mLSecondary Antibody:LI-COR Donkey anti-rabbitSecondary Dilution:1:10,000GNB2L1 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateGNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateGNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-GNB2L1 antibody Titration: 1 ug/mLSample Type: Human liver)
Western Blot (WB)
(WB Suggested Anti-GNB2L1 antibody Titration: 1 ug/mLSample Type: Human liver)
Related Product Information for anti-RACK1 antibody
This is a rabbit polyclonal antibody against GNB2L1. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-RACK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
receptor of activated protein C kinase 1
NCBI Official Synonym Full Names
receptor for activated C kinase 1
NCBI Official Symbol
RACK1
NCBI Official Synonym Symbols
H12.3; HLC-7; PIG21; GNB2L1; Gnb2-rs1
NCBI Protein Information
receptor of activated protein C kinase 1
UniProt Protein Name
Guanine nucleotide-binding protein subunit beta-2-like 1
Protein Family
UniProt Gene Name
GNB2L1
UniProt Synonym Gene Names
HLC-7; RACK1
UniProt Entry Name
GBLP_HUMAN
Research Articles on RACK1
Similar Products
Product Notes
The RACK1 gnb2l1 (Catalog #AAA3205369) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RACK1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RACK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the RACK1 gnb2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEGKIIVDEL KQEVISTSSK AEPPQCTSLA WSADGQTLFA GYTDNLVRVW. It is sometimes possible for the material contained within the vial of "RACK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
