Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Rac2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Rac2 Polyclonal Antibody | anti-RAC2 antibody

Rac2 antibody - C-terminal region

Gene Names
Rac2; AI323801; AI452260
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rac2; Polyclonal Antibody; Rac2 antibody - C-terminal region; anti-RAC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRPCSLL
Sequence Length
192
Applicable Applications for anti-RAC2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Rac2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Rac2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-RAC2 antibody
This is a rabbit polyclonal antibody against Rac2. It was validated on Western Blot

Target Description: Rac2 is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state it binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Rac2 augments the production of reactive oxygen species (ROS) by NADPH oxidase.
Product Categories/Family for anti-RAC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
ras-related C3 botulinum toxin substrate 2
NCBI Official Synonym Full Names
Rac family small GTPase 2
NCBI Official Symbol
Rac2
NCBI Official Synonym Symbols
AI323801; AI452260
NCBI Protein Information
ras-related C3 botulinum toxin substrate 2
UniProt Protein Name
Ras-related C3 botulinum toxin substrate 2
Protein Family
UniProt Gene Name
Rac2
UniProt Entry Name
RAC2_MOUSE

Research Articles on RAC2

Similar Products

Product Notes

The RAC2 rac2 (Catalog #AAA3214433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rac2 antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rac2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAC2 rac2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LALAKDIDSV KYLECSALTQ RGLKTVFDEA IRAVLCPQPT RQQKRPCSLL. It is sometimes possible for the material contained within the vial of "Rac2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.