Rabbit anti-Human RAB43 Polyclonal Antibody | anti-RAB43 antibody

RAB43 (Ras-related Protein Rab-43, RAB11B, Ras-related Protein Rab-41, RAB41)

Cat. Num. AAA647562

• Gene Names: RAB43; RAB41; RAB11B
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RAB43; Polyclonal Antibody; RAB43 (Ras-related Protein Rab-43; RAB11B; Ras-related Protein Rab-41; RAB41); Anti -RAB43 (Ras-related Protein Rab-43; anti-RAB43 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RAB43.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

• Applicable Applications for anti-RAB43 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human RAB43, aa1-212 (NP_940892.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAB43 expression in transfected 293T cell line by RAB43 polyclonal antibody. Lane 1: RAB43 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-RAB43 antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 325910899
• NCBI GeneID: 339122
• NCBI Accession #: NP_001191816.1
• NCBI GenBank Nucleotide #: NM_001204887.1
• UniProt Accession #: Q86YS6; A8K4P9
• Molecular Weight: 23,339 Da
• NCBI Official Full Name: ras-related protein Rab-43 isoform b
• NCBI Official Synonym Full Names: RAB43, member RAS oncogene family
• NCBI Official Symbol: RAB43
• NCBI Official Synonym Symbols: RAB41; RAB11B
• NCBI Protein Information: ras-related protein Rab-43; ras-related protein Rab-41
• UniProt Protein Name: Ras-related protein Rab-43
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB43
• UniProt Synonym Gene Names: RAB41
• UniProt Entry Name: RAB43_HUMAN

Uniprot Description

Function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Ref.5 Ref.6 Ref.7 Ref.8

Subcellular location: Cytoplasmic vesicle › phagosome. Cytoplasmic vesicle › phagosome membrane; Lipid-anchor; Cytoplasmic side

By similarity. Golgi apparatus. Golgi apparatus › trans-Golgi network membrane; Lipid-anchor

By similarity. Golgi apparatus › trans-Golgi network. Note: Recruited to phagosomes containing S.aureus or M.tuberculosis. Ref.5 Ref.7 Ref.8

Tissue specificity: Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver. Ref.1

Sequence similarities: Belongs to the small GTPase superfamily. Rab family.