Testing Data
(Detection limit for recombinant GST tagged RAB43 is approximately 1ng/ml as a capture antibody.)
Mouse RAB43 Monoclonal Antibody | anti-RAB43 antibody
RAB43 (RAB43, Member RAS Oncogene Family, ISY1, MGC90481, RAB11B, RAB41) (Biotin)
Gene Names
RAB43; RAB41; RAB11B
Applications
Western Blot
Purity
Purified
Synonyms
RAB43; Monoclonal Antibody; RAB43 (RAB43; Member RAS Oncogene Family; ISY1; MGC90481; RAB11B; RAB41) (Biotin); RAB41; anti-RAB43 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C11
Specificity
Recognizes RAB43.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
212
Applicable Applications for anti-RAB43 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAB43 (NP_940892, 113aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged RAB43 is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RAB43 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-RAB43 antibody
Mouse monoclonal antibody raised against a partial recombinant RAB43.
Product Categories/Family for anti-RAB43 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ras-related protein Rab-43 isoform a
NCBI Official Synonym Full Names
RAB43, member RAS oncogene family
NCBI Official Symbol
RAB43
NCBI Official Synonym Symbols
RAB41; RAB11B
NCBI Protein Information
ras-related protein Rab-43
UniProt Protein Name
Ras-related protein Rab-43
Protein Family
UniProt Gene Name
RAB43
UniProt Synonym Gene Names
RAB41
UniProt Entry Name
RAB43_HUMAN
Research Articles on RAB43
Similar Products
Product Notes
The RAB43 rab43 (Catalog #AAA6172426) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAB43 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB43 rab43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB43, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
