Rabbit anti-Human, Mouse RAB23 Polyclonal Antibody | anti-RAB23 antibody

RAB23 (Ras-related Protein Rab-23, HSPC137) (Biotin)

Cat. Num. AAA6391684

• Gene Names: RAB23; HSPC137
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB23; Polyclonal Antibody; RAB23 (Ras-related Protein Rab-23; HSPC137) (Biotin); DKFZp781H0695; MGC8900; anti-RAB23 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RAB23. Species Crossreactivity: Mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RAB23 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RAB23, aa1-237, (NP_057361.3, 51715).
• Immunogen Sequence: MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in human colon.)

Western Blot (WB)

(RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in mouse spleen.)

Western Blot (WB)

(RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of RAB23 expression in transfected 293T cell line by RAB23 polyclonal antibody. Lane 1: RAB23 transfected lysate (26.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-RAB23 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 34485714
• NCBI GeneID: 51715
• NCBI Accession #: NP_057361.3; NP_899050.1
• NCBI GenBank Nucleotide #: NM_016277
• Molecular Weight: 26,659 Da
• NCBI Official Full Name: ras-related protein Rab-23
• NCBI Official Synonym Full Names: RAB23, member RAS oncogene family
• NCBI Official Symbol: RAB23
• NCBI Official Synonym Symbols: HSPC137
• NCBI Protein Information: ras-related protein Rab-23
• Protein Family: Ras-related protein

NCBI Description

This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]