Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in human colon.)

Rabbit anti-Human, Mouse RAB23 Polyclonal Antibody | anti-RAB23 antibody

RAB23 (Ras-related Protein Rab-23, HSPC137) APC

Gene Names
RAB23; HSPC137
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB23; Polyclonal Antibody; RAB23 (Ras-related Protein Rab-23; HSPC137) APC; DKFZp781H0695; MGC8900; anti-RAB23 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RAB23. Species Crossreactivity: Mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RAB23 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RAB23, aa1-237, (NP_057361.3, 51715).
Immunogen Sequence
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in human colon.)

Western Blot (WB) (RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in human colon.)

Western Blot (WB)

(RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in mouse spleen.)

Western Blot (WB) (RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in mouse spleen.)

Western Blot (WB)

(RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in HepG2.)

Western Blot (WB) (RAB23 rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of RAB23 expression in transfected 293T cell line by RAB23 polyclonal antibody. Lane 1: RAB23 transfected lysate (26.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAB23 expression in transfected 293T cell line by RAB23 polyclonal antibody. Lane 1: RAB23 transfected lysate (26.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-RAB23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,659 Da
NCBI Official Full Name
ras-related protein Rab-23
NCBI Official Synonym Full Names
RAB23, member RAS oncogene family
NCBI Official Symbol
RAB23
NCBI Official Synonym Symbols
HSPC137
NCBI Protein Information
ras-related protein Rab-23
Protein Family

NCBI Description

This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Research Articles on RAB23

Similar Products

Product Notes

The RAB23 (Catalog #AAA6391683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB23 (Ras-related Protein Rab-23, HSPC137) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RAB23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.