RAB13 Polyclonal Antibody | anti-RAB13 antibody

Anti-RAB13 Antibody

Cat. Num. AAA178316

• Gene Names: RAB13; GIG4
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: RAB13; Polyclonal Antibody; Anti-RAB13 Antibody; Ras-related protein Rab-13; Cell growth-inhibiting gene 4 protein; GIG4; Growth inhibiting gene 4 protein; RAB13 member RAS oncogene family; RAB13_HUMAN; RAS associated protein RAB13; Ras related protein Rab13; member RAS oncogene family; anti-RAB13 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 122

• Applicable Applications for anti-RAB13 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET), different from the related mouse and rat sequences by four amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- RAB13 Picoband antibody, MBS178316, Western blottingAll lanes: Anti RAB13 (MBS178316) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 23KD, 45KDObserved bind size: 23KD, 45KD )

Immunohistochemistry (IHC)

(Anti- RAB13 Picoband antibody, MBS178316, IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- RAB13 Picoband antibody, MBS178316, IHC(P)IHC(P): Rat Intestine Tissue )

Related Product Information for anti-RAB13 antibody

Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-13(RAB13) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.

References

1. "Entrez Gene: RAB13 RAB13, member RAS oncogene family". 2. Zahraoui A, Joberty G, Arpin M, Fontaine JJ, Hellio R, Tavitian A, Louvard D (Feb 1994). "A small rab GTPase is distributed in cytoplasmic vesicles in non polarized cells but colocalizes with the tight junction marker ZO-1 in polarized epithelial cells". J Cell Biol 124 (1-2): 101-15.

NCBI and Uniprot Product Information

• NCBI GI #: 440309849
• NCBI GeneID: 5872
• NCBI Accession #: NP_001258967.1
• NCBI GenBank Nucleotide #: NM_001272038.1
• UniProt Accession #: P51153; Q5U0A6; Q6GPG6; Q96GU4; A8K6B5; D3DV67
• Molecular Weight: 22,774 Da
• NCBI Official Full Name: ras-related protein Rab-13 isoform 2
• NCBI Official Synonym Full Names: RAB13, member RAS oncogene family
• NCBI Official Symbol: RAB13
• NCBI Official Synonym Symbols: GIG4
• NCBI Protein Information: ras-related protein Rab-13
• UniProt Protein Name: Ras-related protein Rab-13
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB13
• UniProt Entry Name: RAB13_HUMAN

NCBI Description

This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013]

Uniprot Description

RAB13: Could participate in polarized transport, in the assembly and/or the activity of tight junctions. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric; G protein, monomeric, Rab; G protein

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: cytoplasm; cytoplasmic vesicle; cytoplasmic vesicle membrane; endocytic vesicle; Golgi apparatus; lamellipodium; lateral plasma membrane; neuron projection; plasma membrane; recycling endosome; recycling endosome membrane; tight junction; trans-Golgi network

Molecular Function: GTP binding; GTPase activity; protein binding

Biological Process: cellular response to insulin stimulus; cortical actin cytoskeleton organization and biogenesis; endocytic recycling; endosome transport; intracellular protein transport; metabolic process; neurite development; nucleocytoplasmic transport; protein secretion; small GTPase mediated signal transduction; vesicle docking during exocytosis