Rabbit anti-Human PZR Polyclonal Antibody | anti-MPZL1 antibody

PZR (Myelin Protein Zero-like Protein 1, Protein Zero-related, MPZL1, UNQ849/PRO1787)

Cat. Num. AAA641607

• Gene Names: MPZL1; PZR; PZRa; PZRb; PZR1b; MPZL1b
• Reactivity: Human
• Applications: Western Blot, Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: PZR; Polyclonal Antibody; PZR (Myelin Protein Zero-like Protein 1; Protein Zero-related; MPZL1; UNQ849/PRO1787); Anti -PZR (Myelin Protein Zero-like Protein 1; anti-MPZL1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MPZL1.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN

• Applicable Applications for anti-MPZL1 antibody: Western Blot (WB), Immunoprecipitation (IP)
• Application Notes: Suitable for use in Immunoprecipitation and Western Blot.
• Immunogen: Full length human MPZL1, aa1-269 (NP_003944.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MPZL1 expression in transfected 293T cell line by MPZL1 polyclonal antibody. Lane 1: MPZL1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MPZL1 transfected lysate using MPZL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with MPZL1 mouse polyclonal antibody)

Related Product Information for anti-MPZL1 antibody

PZR (Protein zero related) is an immunoglobulin superfamily protein that specifically binds the tyrosine phosphatase SHP-2 through its intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIMs). PZR is phosphorylated by c-Src, c-Fyn, c-Lyn, Csk, and c-Abl. PP1, a Src family kinase inhibitor, inhibits PZR phosphorylation. There are three alternatively spliced isoforms designated as PZR, PZRa, and PZRb; both PZRa and PZRb lack ITIMs. PZR is a main receptor of ConA and has an important role in cell signaling via c-Src. PZR is expressed in many cell types and is localized to cell contacts and intracellular granules in BAECs and mesothelioma (REN) cells. Recently, PZR has been implicated as a cell adhesion protein that may be involved in SHP-2-dependent signaling at interendothelial cell contacts. Hypertyrosine phosphorylation of PZR was observed during embryogenesis in a mouse model of Noonan Syndrome.

Product Categories/Family for anti-MPZL1 antibody

Antibodies; Abs to Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 3851145
• NCBI GeneID: 9019
• UniProt Accession #: O95297; Q5R332; Q8IX11; Q9BWZ3; Q9NYK4; Q9UL20; B2REB9; B2REC0
• Molecular Weight: 29,082 Da
• NCBI Official Full Name: protein zero related protein
• NCBI Official Synonym Full Names: myelin protein zero-like 1
• NCBI Official Symbol: MPZL1
• NCBI Official Synonym Symbols: PZR; PZRa; PZRb; PZR1b; MPZL1b
• NCBI Protein Information: myelin protein zero-like protein 1; protein zero related; protein zero-related; immunoglobulin family transmembrane protein
• UniProt Protein Name: Myelin protein zero-like protein 1
• Protein Family: Myelin protein zero-like protein
• UniProt Gene Name: MPZL1
• UniProt Synonym Gene Names: PZR
• UniProt Entry Name: MPZL1_HUMAN

Uniprot Description

PZR: an immunoglobulin superfamily cell surface protein. Contains two tyrosine-based inhibition motifs (ITIMs) responsible for binding of SHP-2. When phosphorylated, it can specifically bind SHP-2, blocking its translocation, and interupting its function. Treatment of several cell lines with ConA caused tyrosine phosphorylation of PZR. Two alternatively spliced isoforms have been reported. One isoform, PZR1b, lacks the ITIMs and has a dominant negative effect upon full-length PZR and its recruitment of SHP-2.

Protein type: Adaptor/scaffold; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: cell surface; focal adhesion; integral to plasma membrane

Molecular Function: protein binding; structural molecule activity

Biological Process: cell-cell signaling; transmembrane receptor protein tyrosine kinase signaling pathway