Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PYHIN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit anti-Human PYHIN1 Polyclonal Antibody | anti-PYHIN1 antibody

PYHIN1 antibody - N-terminal region

Gene Names
PYHIN1; IFIX
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PYHIN1; Polyclonal Antibody; PYHIN1 antibody - N-terminal region; anti-PYHIN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL
Sequence Length
452
Applicable Applications for anti-PYHIN1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PYHIN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PYHIN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-PYHIN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-PYHIN1 antibody
This is a rabbit polyclonal antibody against PYHIN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PYHIN1 belongs to the HIN-200 family. This protein is major mediator of the tumor suppressor activity of IFN in breast cancer cells. It promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization, and HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
Product Categories/Family for anti-PYHIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
pyrin and HIN domain-containing protein 1 isoform beta 2
NCBI Official Synonym Full Names
pyrin and HIN domain family member 1
NCBI Official Symbol
PYHIN1
NCBI Official Synonym Symbols
IFIX
NCBI Protein Information
pyrin and HIN domain-containing protein 1
UniProt Protein Name
Pyrin and HIN domain-containing protein 1
UniProt Gene Name
PYHIN1
UniProt Synonym Gene Names
IFIX
UniProt Entry Name
IFIX_HUMAN

NCBI Description

The protein encoded by this gene belongs to the HIN-200 family of interferon-inducible proteins that share a 200-amino acid signature motif at their C-termini. HIN200 proteins are primarily nuclear and are involved in transcriptional regulation of genes important for cell cycle control, differentiation, and apoptosis. Downregulation of this gene is associated with breast cancer. This protein acts as a tumor suppressor by promoting ubiquitination and subsequent degradation of MDM2, which leads to stabilization of p53/TP53. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

Research Articles on PYHIN1

Similar Products

Product Notes

The PYHIN1 pyhin1 (Catalog #AAA3210138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PYHIN1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PYHIN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PYHIN1 pyhin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMKEEYDKIQ IADLMEEKFP GDAGLGKLIE FFKEIPTLGD LAETLKREKL. It is sometimes possible for the material contained within the vial of "PYHIN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.