Rabbit PUF60 Polyclonal Antibody | anti-PUF60 antibody

PUF60 antibody - C-terminal region

Cat. Num. AAA3205457

• Gene Names: PUF60; FIR; VRJS; RoBPI; SIAHBP1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: PUF60; Polyclonal Antibody; PUF60 antibody - C-terminal region; anti-PUF60 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
• Sequence Length: 542

• Applicable Applications for anti-PUF60 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PUF60
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PUF60 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PUF60 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

()

Western Blot (WB)

(Sample Type: Human 293TWB Suggested Anti-PUF60 Antibody Titration: 0.5ug/ml Positive Control: Human 293T Cell Lysate)

Western Blot (WB)

(Host: RabbitTarget Name: PUF60Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PUF60Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysatePUF60 is supported by BioGPS gene expression data to be expressed in HeLa)

Related Product Information for anti-PUF60 antibody

This is a rabbit polyclonal antibody against PUF60. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.

Product Categories/Family for anti-PUF60 antibody

Polyclonal; RNA Binding Proteins; Transcription Regulation; DNA/RNA/Protein Interactions; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 17298690
• NCBI GeneID: 22827
• NCBI Accession #: NP_055096
• NCBI GenBank Nucleotide #: NM_014281
• UniProt Accession #: Q9UHX1
• Molecular Weight: 58kDa
• NCBI Official Full Name: poly(U)-binding-splicing factor PUF60 isoform b
• NCBI Official Synonym Full Names: poly(U) binding splicing factor 60
• NCBI Official Symbol: PUF60
• NCBI Official Synonym Symbols: FIR; VRJS; RoBPI; SIAHBP1
• NCBI Protein Information: poly(U)-binding-splicing factor PUF60
• UniProt Protein Name: Poly(U)-binding-splicing factor PUF60
• Protein Family: Poly(U)-binding-splicing factor
• UniProt Gene Name: PUF60
• UniProt Synonym Gene Names: FIR; ROBPI; SIAHBP1; FBP-interacting repressor; RoBP1; Siah-BP1
• UniProt Entry Name: PUF60_HUMAN

NCBI Description

This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

FIR: fuse-binding protein-interacting repressor. Interacts with (and may activate) Ro RNPs. Forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. Two alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding; Spliceosome; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: nucleoplasm; Golgi apparatus; mitochondrion; ribonucleoprotein complex; cyclin-dependent protein kinase activating kinase holoenzyme complex

Molecular Function: identical protein binding; protein binding; DNA binding; nucleotide binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; apoptosis; RNA splicing; mRNA processing

Disease: Verheij Syndrome