Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PTRH2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit PTRH2 Polyclonal Antibody | anti-PTRH2 antibody

PTRH2 antibody - C-terminal region

Gene Names
PTRH2; PTH; BIT1; PTH2; PTH 2; CFAP37; IMNEPD; CGI-147
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PTRH2; Polyclonal Antibody; PTRH2 antibody - C-terminal region; anti-PTRH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
Sequence Length
180
Applicable Applications for anti-PTRH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PTRH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PTRH2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PTRH2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PTRH2 antibody
This is a rabbit polyclonal antibody against PTRH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
Product Categories/Family for anti-PTRH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
peptidyl-tRNA hydrolase 2, mitochondrial isoform a
NCBI Official Synonym Full Names
peptidyl-tRNA hydrolase 2
NCBI Official Symbol
PTRH2
NCBI Official Synonym Symbols
PTH; BIT1; PTH2; PTH 2; CFAP37; IMNEPD; CGI-147
NCBI Protein Information
peptidyl-tRNA hydrolase 2, mitochondrial
UniProt Protein Name
Peptidyl-tRNA hydrolase 2, mitochondrial
UniProt Gene Name
PTRH2
UniProt Synonym Gene Names
BIT1; PTH2; PTH 2
UniProt Entry Name
PTH2_HUMAN

NCBI Description

The protein encoded by this gene is a mitochondrial protein with two putative domains, an N-terminal mitochondrial localization sequence, and a UPF0099 domain. In vitro assays suggest that this protein possesses peptidyl-tRNA hydrolase activity, to release the peptidyl moiety from tRNA, thereby preventing the accumulation of dissociated peptidyl-tRNA that could reduce the efficiency of translation. This protein also plays a role regulating cell survival and death. It promotes survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix (ECM), but also promotes apoptosis in cells that have lost their attachment to the ECM, a process called anoikos. After loss of cell attachment to the ECM, this protein is phosphorylated, is released from the mitochondria into the cytosol, and promotes caspase-independent apoptosis through interactions with transcriptional regulators. This gene has been implicated in the development and progression of tumors, and mutations in this gene have been associated with an infantile multisystem neurologic, endocrine, and pancreatic disease (INMEPD) characterized by intellectual disability, postnatal microcephaly, progressive cerebellar atrophy, hearing impairment, polyneuropathy, failure to thrive, and organ fibrosis with exocrine pancreas insufficiency (PMID: 25574476). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2015]

Uniprot Description

PTRH2: The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis. Monomer. Belongs to the PTH2 family.

Protein type: EC 3.1.1.29; Mitochondrial; Hydrolase

Chromosomal Location of Human Ortholog: 17q23.1

Cellular Component: membrane; mitochondrion; cytosol

Molecular Function: protein binding; aminoacyl-tRNA hydrolase activity

Biological Process: apoptosis; metabolic process

Disease: Neurologic, Endocrine, And Pancreatic Disease, Multisystem, Infantile-onset

Research Articles on PTRH2

Similar Products

Product Notes

The PTRH2 ptrh2 (Catalog #AAA3207492) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTRH2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTRH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTRH2 ptrh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNPEMLKQWE YCGQPKVVVK APDEETLIAL LAHAKMLGLT VSLIQDAGRT. It is sometimes possible for the material contained within the vial of "PTRH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.