Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTPN7 expression in transfected 293T cell line by PTPN7 polyclonal antibody. Lane 1: PTPN7 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PTPN7 Polyclonal Antibody | anti-PTPN7 antibody

PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PTPN7; Polyclonal Antibody; PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7; Protein-tyrosine Phosphatase LC-PTP; Hematopoietic Protein-tyrosine Phosphatase; HEPTP); Anti -PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7; anti-PTPN7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTPN7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Applicable Applications for anti-PTPN7 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PTPN7, aa1-360 (NP_002823.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN7 expression in transfected 293T cell line by PTPN7 polyclonal antibody. Lane 1: PTPN7 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTPN7 expression in transfected 293T cell line by PTPN7 polyclonal antibody. Lane 1: PTPN7 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PTPN7 and MAPK1 HeLa cells were stained with PTPN7 rabbit purified polyclonal 1:1200 and MAPK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PTPN7 and MAPK1 HeLa cells were stained with PTPN7 rabbit purified polyclonal 1:1200 and MAPK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-PTPN7 antibody
PTPN7 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN7 is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The noncatalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP has been shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which is thought to function through dephosphorylating the molecules related to MAP kinase pathway.
Product Categories/Family for anti-PTPN7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
PTPN7 protein
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 7<
NCBI Official Symbol
PTPN7
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 7

Similar Products

Product Notes

The PTPN7 (Catalog #AAA6001347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PTPN7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVQAHGGRSR AQPLTLSLGA AMTQPPPEKT PAKKHVRLQE RRGSNVALML DVRSLGAVEP ICSVNTPREV TLHFLRTAGH PLTRWALQRQ PPSPKQLEEE FLKIPSNFVS PEDLDIPGHA SKDRYKTILP NPQSRVCLGR AQSQEDGDYI NANYIRGYDG KEKVYIATQG PMPNTVSDFW EMVWQEEVSL IVMLTQLREG KEKCVHYWPT EEETYGPFQI RIQDMKECPE YTVRQLTIQY QEERRSVKHI LFSAWPDHQT PESAGPLLRL VAEVEESPET AAHPGPIVVH CSAGIGRTGC FIATRIGCQQ LKARGEVDIL GIVCQLRLDR GGMIQTAEQY QFLHHTLALY AGQLPEEPSP. It is sometimes possible for the material contained within the vial of "PTPN7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.