Rabbit anti-Human PTPN7 Polyclonal Antibody | anti-PTPN7 antibody

PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (HRP)

Cat. Num. AAA6391433

• Gene Names: PTPN7; LPTP; HEPTP; PTPNI; BPTP-4; LC-PTP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTPN7; Polyclonal Antibody; PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7; Protein-tyrosine Phosphatase LC-PTP; Hematopoietic Protein-tyrosine Phosphatase; HEPTP) (HRP); anti-PTPN7 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PTPN7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-PTPN7 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PTPN7, aa1-360 (NP_002823.2).
• Immunogen Sequence: MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN7 expression in transfected 293T cell line by PTPN7 polyclonal antibody. Lane 1: PTPN7 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PTPN7 and MAPK1 HeLa cells were stained with PTPN7 rabbit purified polyclonal 1:1200 and MAPK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-PTPN7 antibody

PTPN7 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN7 is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The noncatalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP has been shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which is thought to function through dephosphorylating the molecules related to MAP kinase pathway.

Product Categories/Family for anti-PTPN7 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 18375658
• NCBI GeneID: 5778
• NCBI Accession #: NP_002823.2
• NCBI GenBank Nucleotide #: NM_002832.2
• Molecular Weight: 43.1 kDa (384aa), confirmed by MALDI-TOF
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 7 isoform 1
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, non-receptor type 7
• NCBI Official Symbol: PTPN7
• NCBI Official Synonym Symbols: LPTP; HEPTP; PTPNI; BPTP-4; LC-PTP
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 7
• Protein Family: Tyrosine-protein phosphatase non-receptor

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This gene is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The non-catalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP was shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2010]