Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTPN22Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PTPN22 Polyclonal Antibody | anti-PTPN22 antibody

PTPN22 Antibody - middle region

Gene Names
PTPN22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTPN22; Polyclonal Antibody; PTPN22 Antibody - middle region; anti-PTPN22 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL
Sequence Length
563
Applicable Applications for anti-PTPN22 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%; Yeast: 82%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PTPN22
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTPN22Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PTPN22Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PTPN22 antibody
This is a rabbit polyclonal antibody against PTPN22. It was validated on Western Blot

Target Description: This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Product Categories/Family for anti-PTPN22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 22 isoform 3
NCBI Official Synonym Full Names
protein tyrosine phosphatase non-receptor type 22
NCBI Official Symbol
PTPN22
NCBI Official Synonym Symbols
LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 22
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 22
UniProt Gene Name
PTPN22
UniProt Synonym Gene Names
PTPN8; LyP; PEP
UniProt Entry Name
PTN22_HUMAN

NCBI Description

This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Mar 2009]

Uniprot Description

PTPN22: Seems to act on Cbl. May play a role in regulating the function of Cbl and its associated protein kinases. Acts as negative regulator of T-cell receptor (TCR) signaling. Dephosphorylates and inactivates the SRC family kinases. Interacts with CSK. Interacts with LPXN. Predominantly expressed in lymphoid tissues and cells. Isoform 1 is expressed in thymocytes and both mature B and T-cells. Down-regulated by phosphorylation. Belongs to the protein-tyrosine phosphatase family. Non-receptor class 4 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, tyrosine (non-receptor); EC 3.1.3.48

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: internal side of plasma membrane; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding; protein tyrosine phosphatase activity; kinase binding; SH3 domain binding

Biological Process: regulation of B cell receptor signaling pathway; regulation of natural killer cell proliferation; negative regulation of T cell receptor signaling pathway; protein amino acid dephosphorylation; negative regulation of T cell activation; T cell differentiation; regulation of innate immune response

Disease: Diabetes Mellitus, Insulin-dependent; Systemic Lupus Erythematosus; Rheumatoid Arthritis

Research Articles on PTPN22

Similar Products

Product Notes

The PTPN22 ptpn22 (Catalog #AAA3211929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPN22 Antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTPN22 ptpn22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAPRIDDEIP PPLPVWTPES FIVVEEAGEF SPNVPKSLSS AVKVKIGTSL. It is sometimes possible for the material contained within the vial of "PTPN22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.