Western Blot (WB)
(Host: RabbitTarget Name: PTPN20ASample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit PTPN20A Polyclonal Antibody | anti-PTPN20A antibody
PTPN20A Antibody - middle region
Gene Names
PTPN20; CT126; PTPN20A; PTPN20B; bA42B19.1; bA142I17.1
Reactivity
Human, Pig, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTPN20A; Polyclonal Antibody; PTPN20A Antibody - middle region; anti-PTPN20A antibody
Host
Rabbit
Reactivity
Human, Pig, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR
Sequence Length
339
Applicable Applications for anti-PTPN20A antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 79%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PTPN20A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PTPN20ASample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PTPN20ASample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PTPN20A antibody
This is a rabbit polyclonal antibody against PTPN20A. It was validated on Western Blot
Target Description: The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes and several are mutated in human diseases. Chromosome 10q contains a segmental duplication resulting in multiple copies of the protein tyrosine phosphatase, non-receptor type 20 gene. The two nearly identical copies are designated as PTPN20A and PTPN20B. A third copy is only partially duplicated and contains a pseudogene, designated as PTPN20C. This gene encodes the more centromeric copy, PTPN20A. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Target Description: The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes and several are mutated in human diseases. Chromosome 10q contains a segmental duplication resulting in multiple copies of the protein tyrosine phosphatase, non-receptor type 20 gene. The two nearly identical copies are designated as PTPN20A and PTPN20B. A third copy is only partially duplicated and contains a pseudogene, designated as PTPN20C. This gene encodes the more centromeric copy, PTPN20A. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-PTPN20A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 20 isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase non-receptor type 20
NCBI Official Symbol
PTPN20
NCBI Official Synonym Symbols
CT126; PTPN20A; PTPN20B; bA42B19.1; bA142I17.1
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 20
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 20
UniProt Gene Name
PTPN20
UniProt Synonym Gene Names
hPTPN20
NCBI Description
The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Uniprot Description
Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.
Research Articles on PTPN20A
Similar Products
Product Notes
The PTPN20A ptpn20 (Catalog #AAA3218342) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPN20A Antibody - middle region reacts with Human, Pig, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN20A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTPN20A ptpn20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEEKTAAYDI MQEFMALELK NLPGEFNSGN QPSNREKNRY RDILPYDSTR. It is sometimes possible for the material contained within the vial of "PTPN20A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
