Mouse TOPORS Monoclonal Antibody | anti-TOPORS antibody

TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (PE)

Cat. Num. AAA6184307

• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: TOPORS; Monoclonal Antibody; TOPORS (Topoisomerase I Binding; Arginine/Serine-Rich; LUN; P53BP3; RP31; TP53BPL) (PE); Topoisomerase I Binding; TP53BPL; anti-TOPORS antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G4
• Specificity: Recognizes TOPORS.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1045

• Applicable Applications for anti-TOPORS antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TOPORS (NP_005793, 98aa-205aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TOPORS is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TOPORS on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TOPORS on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-TOPORS antibody

Mouse monoclonal antibody raised against a partial recombinant TOPORS.

Product Categories/Family for anti-TOPORS antibody

Antibodies; Topoisomerases

NCBI and Uniprot Product Information

• NCBI GI #: 40805104
• NCBI Accession #: NP_005793
• NCBI GenBank Nucleotide #: NP_005793.2
• UniProt Accession #: Q9NS56
• NCBI Official Full Name: E3 ubiquitin-protein ligase Topors isoform 1
• UniProt Protein Name: E3 ubiquitin-protein ligase Topors
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: TOPORS
• UniProt Synonym Gene Names: LUN; TP53BPL; p53-binding protein 3; p53BP3
• UniProt Entry Name: TOPRS_HUMAN

Uniprot Description

TOPORS: Functions as an E3 ubiquitin-protein ligase and as an E3 SUMO1-protein ligase. Probable tumor suppressor involved in cell growth, cell proliferation and apoptosis that regulates p53/TP53 stability through ubiquitin-dependent degradation. May regulate chromatin modification through sumoylation of several chromatin modification-associated proteins. May be involved in DNA damage- induced cell death through IKBKE sumoylation. Interacts with PARK7/DJ-1. Interacts with TOP1. Interacts with p53/TP53; can both ubiquitinate and sumoylate p53/TP53. Interacts with the SUMO1 conjugating enzyme UBE2I. Interacts with SUMO1. Interacts with NKX3-1; polyubiquitinates NKX3-1 and induces its proteasomal degradation. Interacts with SIN3A; sumoylates SIN3A. Interacts with IKBKE; induced by DNA damage. By genotoxic agents such as cisplatin and camptothecin. Expressed at highest levels in testis and at lower levels in adrenal gland, bone marrow, brain, colon, heart, kidney, liver, muscle, ovary, pancreas, placenta, prostate, skeletal muscle, skin, small intestine, spleen, stomach, testis, thymus, thyroid and uterus. Expressed in the alveolar epithelium of the lung. Expression is commonly decreased in colon adenocarcinomas and lung cancers. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ligase; Ubiquitin ligase; Cell cycle regulation; Ubiquitin conjugating system; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: centriole; spindle pole; PML body; cytoplasmic dynein complex; nuclear speck; midbody; nucleus; photoreceptor connecting cilium; ubiquitin ligase complex; gamma-tubulin complex

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-protein ligase activity; SUMO ligase activity; antigen binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; protein monoubiquitination; proteasomal ubiquitin-dependent protein catabolic process; retinal rod cell development; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; regulation of cell proliferation; protein sumoylation; retinal cone cell development; DNA damage response, signal transduction resulting in induction of apoptosis; positive regulation of ubiquitin-protein ligase activity; maintenance of protein localization in nucleus; response to DNA damage stimulus; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; negative regulation of apoptosis

Disease: Retinitis Pigmentosa 31