Rabbit anti-Human PTPA Polyclonal Antibody | anti-PTPA antibody

PTPA Antibody - middle region

Cat. Num. AAA3222700

• Gene Names: PTPA; PP2A; PR53; PPP2R4
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PTPA; Polyclonal Antibody; PTPA Antibody - middle region; anti-PTPA antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPT
• Sequence Length: 323

• Applicable Applications for anti-PTPA antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PPP2R4
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP2R4Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-PTPA antibody

Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Categories/Family for anti-PTPA antibody

Polyclonal; Developmental Biology; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 301129290
• NCBI GeneID: 5524
• NCBI Accession #: NP_001180326.1
• NCBI GenBank Nucleotide #: NM_001193397.1
• UniProt Accession #: Q15257
• Molecular Weight: 35 kDa
• NCBI Official Full Name: serine/threonine-protein phosphatase 2A activator isoform e
• NCBI Official Synonym Full Names: protein phosphatase 2 phosphatase activator
• NCBI Official Symbol: PTPA
• NCBI Official Synonym Symbols: PP2A; PR53; PPP2R4
• NCBI Protein Information: serine/threonine-protein phosphatase 2A activator
• UniProt Protein Name: Serine/threonine-protein phosphatase 2A activator
• Protein Family: Prolyl tripeptidyl peptidase
• UniProt Gene Name: PPP2R4
• UniProt Synonym Gene Names: PTPA; PTPA
• UniProt Entry Name: PTPA_HUMAN

NCBI Description

Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP2R4: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine- protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A. Associates with PP2A heterodimeric core enzyme PP2A(D), composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A). Interacts with PPP2CB. Widely expressed. Belongs to the PTPA-type PPIase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; EC 5.2.1.8; Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: nucleoplasm; protein phosphatase type 2A complex; cytoplasm; nucleus

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; protein homodimerization activity; protein phosphatase 2A binding; protein heterodimerization activity; ATPase activity; protein phosphatase type 2A regulator activity; ATP binding; protein tyrosine phosphatase activator activity; receptor binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; negative regulation of protein amino acid dephosphorylation; protein peptidyl-prolyl isomerization; positive regulation of apoptosis; metabolic process; mitotic spindle organization and biogenesis in nucleus; negative regulation of phosphoprotein phosphatase activity; regulation of phosphoprotein phosphatase activity; positive regulation of protein amino acid dephosphorylation